SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015180 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015180
Domain Number 1 Region: 115-306
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.49e-87
Family p53 DNA-binding domain-like 0.000000524
Further Details:      
 
Domain Number 2 Region: 487-553
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.51e-23
Family SAM (sterile alpha motif) domain 0.0000164
Further Details:      
 
Domain Number 3 Region: 346-386
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.000000000000497
Family p53 tetramerization domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015180   Gene: ENSGGOG00000015559   Transcript: ENSGGOT00000015615
Sequence length 636
Comment pep:novel chromosome:gorGor3.1:1:3750741:3831490:1 gene:ENSGGOG00000015559 transcript:ENSGGOT00000015615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTS
VMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTD
YPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPV
YKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPY
EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRRSFEGRICACPGR
DRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHGDEDTYYLQVR
GRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGPVLSPMNKVHGG
MNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSSHSTQSMVSGSH
CTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMT
IWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRG
GPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH
Download sequence
Identical sequences G3RHQ4
ENSGGOP00000015180 XP_004024577.1.27298 ENSGGOP00000015180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]