SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015218 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015218
Domain Number 1 Region: 12-151
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 5.14e-37
Family Gelsolin-like 0.00000749
Further Details:      
 
Domain Number 2 Region: 383-521
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.67e-35
Family Gelsolin-like 0.00000886
Further Details:      
 
Domain Number 3 Region: 250-439
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 7.59e-34
Family C-terminal, gelsolin-like domain of Sec23/24 0.0091
Further Details:      
 
Domain Number 4 Region: 615-720
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.59e-32
Family Gelsolin-like 0.00000771
Further Details:      
 
Domain Number 5 Region: 140-242
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.31e-26
Family Gelsolin-like 0.0000196
Further Details:      
 
Domain Number 6 Region: 514-607
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.57e-21
Family Gelsolin-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015218   Gene: ENSGGOG00000015597   Transcript: ENSGGOT00000015653
Sequence length 721
Comment pep:novel chromosome:gorGor3.1:7:12660792:12742939:1 gene:ENSGGOG00000015597 transcript:ENSGGOT00000015653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRAGAMARELYHEEFARAGKQAGLQVWRIEKLELVPVPQSAHGDFYVGDAYLVLHTAKTS
RGFTYRQHVWLGKECSQDESTAAAIFTVQMDDYLGGKPVQNRELQGYESNDFVSYFKGGL
KYKAGGVASGLNHVLMNDLTAKRLLHVKGRRVVRATEVPLSWDSFNKGDCFIIDLGTEIY
QWCGSSCNKYERLKANQVATGIRYNERKGRSELIVMEEGSEPSELIKVLGEKPELPDGGD
DDDIIADISNRKMAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHGAAKQIFV
WKGKDANPQERKAAMKTAEEFLQQMNYSKNTQQIQVLPEGGETPIFKQFFKDWRDKDQSD
GFGKVYVTEKVAQIKQIPFDASKLHSSPQMAAQHNMVDDGSGKVEIWRVENNGRIQVDQN
SYGEFYGGDCYIILYTYPRGQIIYTWQGANATRDELTTSAFLTVQLDRSLGGQAVQIRVS
QGKEPVHLLSLFKDKPLIIYKNGTSKKGGQAPAPPTRLFQVRRNLASITRIVEVDVDANS
LNSNDVFVLKLPQNSGYIWVGKGASQEEEKGAEYVASVLKCKTLRIQEGEEPEEFWNSLG
GKKDYQTSPLLETQAEDHPPRLYGCSNKTGRFVIEEVPGEFTQDDLAEDDVMLLDAWEQI
FIWIGKDANEVEKKESLKSAKMYLETDPSGRDKRTPIVIIKQGHEPPTFTGWFLGWDSSK
W
Download sequence
Identical sequences ENSGGOP00000015218 ENSGGOP00000023797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]