SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015226 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015226
Domain Number 1 Region: 655-922
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.23e-60
Family Protein kinases, catalytic subunit 0.000000063
Further Details:      
 
Domain Number 2 Region: 33-216
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-56
Family Ephrin receptor ligand binding domain 0.00000426
Further Details:      
 
Domain Number 3 Region: 356-569
Classification Level Classification E-value
Superfamily Fibronectin type III 7.82e-33
Family Fibronectin type III 0.0000564
Further Details:      
 
Domain Number 4 Region: 946-1017
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.44e-17
Family SAM (sterile alpha motif) domain 0.0014
Further Details:      
 
Domain Number 5 Region: 286-349,395-415
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000481
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015226   Gene: ENSGGOG00000015601   Transcript: ENSGGOT00000015661
Sequence length 1020
Comment pep:novel chromosome:gorGor3.1:7:141353866:141362105:1 gene:ENSGGOG00000015601 transcript:ENSGGOT00000015661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVS
VLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVS
GGTCRETFTLYYRQAEEPDSPDSVSSWHLKRWTKVDTIAADESFAAWAVGPHGAGQRAGL
QLNVKERSFGPLTQRGFYVAFQDTGACLALVAVRLFSYTCPAVLRSFASFPETQASGAGG
ASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGCRCQPGYQPARGDK
ACQACPRGLYKASAGNAPCSPCPARSHAPNPAAPVCPCLEGFYRASSDPPEAPCTGPPSA
PQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGGGSTCRRCRDEVH
FDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEVPSAVP
VVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTSETNTATVTQLSP
GHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSILGALAFLLLAAI
TVLAVVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIRELAREVDPAYIKI
EEVIGTGSFGEVRRGRLQPRGRREQTVAIQALWAGGAESLQMTFLGRAAVLGQFQHPNIL
RLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLSSFAFV
HRSLSAHSVLVNSHLVCKVARLGHSPQLLLFAFDFTPQGPSCLLRWAAPEVIAHGKHTTS
SDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKD
RARRPHFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIG
LECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV
Download sequence
Identical sequences ENSGGOP00000015226 ENSGGOP00000015226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]