SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015593 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015593
Domain Number 1 Region: 36-183
Classification Level Classification E-value
Superfamily L domain-like 1.63e-34
Family Internalin LRR domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015593   Gene: ENSGGOG00000015989   Transcript: ENSGGOT00000016041
Sequence length 190
Comment pep:novel chromosome:gorGor3.1:14:54891576:54942837:1 gene:ENSGGOG00000015989 transcript:ENSGGOT00000016041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCI
EKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHVMKKLKIL
YMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTP
VIKGDEEEDN
Download sequence
Identical sequences A0A096NUK0 A0A2K5LRX1 A0A2K5TPJ8 F7CEH1 G3RIT1 K7D4W5
ENSMMUP00000006520 ENSPTRP00000011064 ENSGGOP00000015593 ENSPANP00000016724 ENSGGOP00000015593 NP_001247523.1.72884 XP_001141594.1.37143 XP_003824195.1.60992 XP_005561782.1.63531 XP_007985416.1.81039 XP_007985418.1.81039 XP_011926171.1.92194 XP_018865404.1.27298 ENSPTRP00000011064 ENSMMUP00000006520 9544.ENSMMUP00000006520 9598.ENSPTRP00000011064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]