SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015705 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015705
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily HAD-like 5.2e-24
Family Magnesium-dependent phosphatase-1, Mdp1 0.000000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015705   Gene: ENSGGOG00000016100   Transcript: ENSGGOT00000016156
Sequence length 175
Comment pep:novel chromosome:gorGor3.1:14:5192884:5194894:-1 gene:ENSGGOG00000016100 transcript:ENSGGOT00000016156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQS
LGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIF
FDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPRSSLEESPFEA
Download sequence
Identical sequences ENSGGOP00000015705 9598.ENSPTRP00000056544 ENSGGOP00000015705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]