SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015802 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015802
Domain Number 1 Region: 580-683
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-31
Family SH2 domain 0.00000361
Further Details:      
 
Domain Number 2 Region: 5-77
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000028
Family SH3-domain 0.00011
Further Details:      
 
Domain Number 3 Region: 329-394
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000242
Family SH2 domain 0.0000716
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015802   Gene: ENSGGOG00000016197   Transcript: ENSGGOT00000016254
Sequence length 695
Comment pep:novel chromosome:gorGor3.1:19:18532336:18546059:1 gene:ENSGGOG00000016197 transcript:ENSGGOT00000016254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGL
NERTRQRGDFPGTYVEFPLPARPRDGAPEPGEQQAGALERGVVPSDPWSPLLYKWVQEVT
HAMRKGACMGRCEGGSSRQWGQRGQRLWSRTLMCDAGPGLPASGISRAQACVLPRPEGAG
GGPVWAPSQNLPLPLVTATSLLCLASVQPPYTAPRGAAAQPHPLNLPGASPPRARAASNG
GRQRAAEAGMLHTKGPVELGSQGWEGAGPRMPPAPARRGFSFSKSIKKGEPNLLYDFQWL
PQKLPTRWLQTMEMYLLINVCIHSSRAWVDYSSLCLGKGGNNKLIKVFHRDGHYGFSEPL
TFCSVVDLINHYRHESLAQYNAKLDTRLLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQY
QDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKCSKEYLERFRREG
NEKEMQRILLNSERLKSRIAEIHESRTKLEQQLRAQASDNREIDKRMNSLKPDLMQLRKI
RDQYLVSLGGWQVSDQGPPRHPPPPPPDPSQYALMEDEDDLPHHEERTWYVGKINRTQAE
EMLSGKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTATGFGFAEPYNLYGSLKELV
LHYQHASLVQHNDALTVTLAHPAEHRGPAPSRAAP
Download sequence
Identical sequences ENSGGOP00000024544 ENSGGOP00000015802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]