SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015895 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015895
Domain Number 1 Region: 625-924
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-80
Family Protein kinases, catalytic subunit 0.000000000355
Further Details:      
 
Domain Number 2 Region: 38-209
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.04e-72
Family Ephrin receptor ligand binding domain 0.000000224
Further Details:      
 
Domain Number 3 Region: 337-542
Classification Level Classification E-value
Superfamily Fibronectin type III 6.87e-40
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 4 Region: 921-994
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.35e-21
Family SAM (sterile alpha motif) domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015895
Domain Number - Region: 265-341,376-394
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000286
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015895   Gene: ENSGGOG00000016281   Transcript: ENSGGOT00000016348
Sequence length 997
Comment pep:novel chromosome:gorGor3.1:3:185929527:185951457:1 gene:ENSGGOG00000016281 transcript:ENSGGOT00000016348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARARPPPPPSPPPGLLPLLPPLLLLPLLLPAGCRALEETLMDTKWVTSELAWTSHPESG
WEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIPN
IPGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRSF
GPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGTC
IPNAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGPC
LPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWSE
PRDLGGRDDLLYNVICKKCHGAGGASACSRCDDNVEFVPRQLGLTERRVHISHLLAHTRY
TFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPNG
VILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEFE
TTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQYI
APGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREVF
VAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDS
FLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSR
FLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWD
MSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAAS
LKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMT
AEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
Download sequence
Identical sequences A0A2I2YR65
ENSGGOP00000015895 ENSGGOP00000015895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]