SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015938 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015938
Domain Number 1 Region: 86-147
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.31e-17
Family Chaperone J-domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015938   Gene: ENSGGOG00000016338   Transcript: ENSGGOT00000016392
Sequence length 150
Comment pep:novel chromosome:gorGor3.1:13:25108646:25195190:1 gene:ENSGGOG00000016338 transcript:ENSGGOT00000016392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARGVIAPVGESLRYAEYLQPSGKRPDADVDQQGLVRSLIAVGLGVAALAFAGRYAFRI
WKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVM
ILNHPDKGGSPYVAAKINEAKDLLETTTKH
Download sequence
Identical sequences G3RJP3
ENSGGOP00000015938 XP_004054487.1.27298 ENSGGOP00000015938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]