SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015962 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015962
Domain Number 1 Region: 62-237
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.73e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015962   Gene: ENSGGOG00000016353   Transcript: ENSGGOT00000016416
Sequence length 985
Comment pep:novel chromosome:gorGor3.1:15:10984910:11006720:1 gene:ENSGGOG00000016353 transcript:ENSGGOT00000016416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWDQRLVRLALLQHLRAFYGIKVKGVRGQCDRRRHETAATEIGTVFGTAFHPLTRTTVAY
FRRLPSVFLVDACTSLEEHIHTEGLFRKSGSVIRLKALKNKVDHGEGCLSSAPPCDIAGL
LKQFFRELPEPILPADLHEALLKAQQLGTEEKNKATLLLSCLLADHTVHVLRYFFNFLRN
VSLRSSENKMDSSNLAVIFAPNLLQTSEGHEKMSSNTEKKLRLQAAVVQTLIDYASDIGK
IICLNEENLCFFQRNYEVPAPPAKKKRTCISDFVSGALNKFKPNRTPSITPQQERIAQLS
ESPVILTPNAKRKLPVDSSHGFSSKKRKSIKHNFNFELLPSNLFNSSSTPVSVHIDTSSE
GSSQSSLSPVLIGGNHLITAGVPRRSKRIAGKKVCRVESGKAGCFSPKISHKEKVRRSLR
LKFNLGKNGRENGCSGVNRYESVGWRLANQQSLKNRIESVKTGLLFSPDVDEKLPKKGSE
KISKSEETLLTPERLVGTNYRMSWTGPNNSSFQEVDANEASSMVENLEVENSLEPDIMVE
KSPATSCELTPSNLNNKHNSNITSSPLSGDENNVTKETLVKVQKAFSESGSNLHALMNQR
QSSVTNVGKENLFETNDLTIVESKEKYEHHTGKGEKCFSERDFSPLQTQTFNRETTIKCY
STQMKMEHEKDIHSNMPKDYLSKQEFSSDEEIKKQQSPKDKLNNKLKENENMMEGNLPKC
AAHSKDEQSTCVVTNLSKPRPMRIAKQQSLETCEKTVSESSQMTEHRKVSDHIQWFNKLS
LNEPNRIKVKSPLKFQRTPVRQSVRRINSLLEYSRQPTGHKLASLGDTASPLVKSVSCDG
ALSSCMESASKDSSVSCIKSGPKEQKSMSCEESNVGAISKSSMELPSKSFLKMRKHPDSV
NASLRSTTVYKQKMLSDGQVKVPLDDLTNHDIVKPVVNNNMGISSGINNRVLRRPSERGR
AWYKGSPKHPIGKTQLLPTSKPVDL
Download sequence
Identical sequences ENSGGOP00000015962 ENSGGOP00000026138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]