SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016026 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016026
Domain Number 1 Region: 916-1091
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00052
Further Details:      
 
Domain Number 2 Region: 491-607
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.75e-32
Family Pyk2-associated protein beta ARF-GAP domain 0.0018
Further Details:      
 
Domain Number 3 Region: 223-381
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-24
Family Pleckstrin-homology domain (PH domain) 0.00045
Further Details:      
 
Domain Number 4 Region: 1177-1324
Classification Level Classification E-value
Superfamily PH domain-like 2.02e-18
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 
Domain Number 5 Region: 8-64
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000412
Family SAM (sterile alpha motif) domain 0.0043
Further Details:      
 
Domain Number 6 Region: 607-786
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000204
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 7 Region: 392-499
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000204
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 8 Region: 801-909
Classification Level Classification E-value
Superfamily PH domain-like 0.00000011
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 9 Region: 1134-1197
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000317
Family Ras-binding domain, RBD 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016026   Gene: ENSGGOG00000016409   Transcript: ENSGGOT00000016481
Sequence length 1547
Comment pep:novel chromosome:gorGor3.1:5:125261387:125289603:-1 gene:ENSGGOG00000016409 transcript:ENSGGOT00000016481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPQDLDIAVWLATVHLEQYADTFRRHGLATAGAARGLGHEELKQLGISATGHRKRILR
LLQTGTEEGSLDPKSDSAMEPSPSPAPQAQPPKPVPKPRTVFGGLSGPATTRRPGLSPAL
GGPGVSRSPEPSPRPPPLPTSSSEQSSALNTVEMMPNSIYFGLDSRGRAQASQDKAPDSS
QISAPTPALRPTTGTVHIMDPGCLYYGVQPVGTPGAPDRRESRGVCQDRAEHRRLSRQDL
EAREDAGYASLELPGDSTLLSPTLETEETSDDLISPYASFSFTADRLTPLLSGWLDKLSP
QGNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSSKDNKFQVITGQRVFVF
RTESEAQRDMWCSTLQSCLKEQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPGEL
ALYKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSFTAESGGARQSWAAALQ
EAVTETLSDYEVAEKIWSNRANRHCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGIS
KVQSLKLDTSVWSNEIVQLFIVLGNNRANRFWAGTLPPGEGLHPDATPGPRGEFISQKYR
LGLFRKPHPQYPDHSQLLQALCAAVAGPNLLKNMTQLLCVEAFEGEEPWFPPALDGRCPG
LLPSDPSPGVYNEVVVPATYSGFLYCSPVSNKAGPSPPRRGRDAPPRLWCVLGAALEMFA
SENSPEPLSLIQPQDIVCLGVSPPPTDPGDLDRFPFSFELILTGGRIQHFGTDGADSLEA
WTSAVGKWFSPLSCHQLLGPGLLRLGRLWLRSPSHTAPAPGLWLSGFGLLRGDHLFLCSA
PGPGPPAPEDMVHLRRLQEISVVSAADTPDKKEHLVLVETGRTLYLQGEGRLDFTAWNAA
IGGAAGGGGTGLQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEF
RRDARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYK
DVIGCLPRVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRVL
QELIDGYISVFDIDSDQVAQIDLEVSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVTLK
VSPTLTAEELTNQVLEMRGTAAGMDLWVTFEIREHGELERPLHPKEKVLEQALQWCQLPE
PCSASLLLKKVPLAQAGCLFTGIRRESPRVGLLRCREEPPRLLGSRFQERFFLLRGRCLL
LLKEKKSSKPEREWPLEGAKVYLGIRKKLKPPTPWGFTLILEKMHLYLSCTDEDEMWDWT
TSILKAQHDDQQPVVLRRHSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRR
TLSMFFPMKSSQGSVEEQEELEEPVYEEPVYEEVGAFPELIQDTSTSFSTTREWTVKPEN
PLTSQKSLDQPFLSKSSTLGQEERPPEPPPGPPSKSGPQARGSLEEQLLQELSSLILRKG
ETTAGLGSPSQPSSPQSPSPTGLPTQTPGFPTQPPCTSSPPSSQPLT
Download sequence
Identical sequences ENSGGOP00000016026 ENSGGOP00000016026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]