SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016046 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016046
Domain Number 1 Region: 348-532,645-864,894-924
Classification Level Classification E-value
Superfamily Ras GEF 1.7e-103
Family Ras GEF 0.00048
Further Details:      
 
Domain Number 2 Region: 97-227
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.46e-28
Family DEP domain 0.0000404
Further Details:      
 
Domain Number 3 Region: 553-654
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-26
Family Ras-binding domain, RBD 0.0082
Further Details:      
 
Domain Number 4 Region: 221-350
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.12e-26
Family cAMP-binding domain 0.0000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016046   Gene: ENSGGOG00000016430   Transcript: ENSGGOT00000016502
Sequence length 924
Comment pep:novel chromosome:gorGor3.1:12:45650278:45674655:-1 gene:ENSGGOG00000016430 transcript:ENSGGOT00000016502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVGWPGENCWQVGLAVEDSPALGAPRVGALPDVVPEGTLLNMVLRRMHRPRSCSYQLLL
EHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNLIRDRK
YHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQ
FYRFPGPEPEPVGTHEMEEELAEAVALLSQRGPDALLTVALRKPPGQRTDEELDLIFEEL
LHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGL
VTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDFNRIIKDVEAKTMRLEEHG
KVVLVLERASQGAGPSRPPTPGRNRRYTVMSGTPEKILELLLEAMGPDSSAHDPTETFLS
DFLLTHRVFMPSAQLCAALLHHFHVEPAGGSEQERSTYVCNKRQQILRLVSQWVALYGSM
LHTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVW
LPNQDEPLPGSSCAIRVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKGQ
VLVKVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELIPHPDQLGPTVGSAEGLD
LVSAKDLAGQLTDHDWSLFNSIHQVELIHYVLGPQHLRDVTTANLERFMRRFNELQYWVA
TELCLCPVPGSRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHK
VRKLYSALERLLDPSWNHRVYRLALAKLSPPVIPFMPLLLKDMTFIHEGNHTLVENLINF
EKMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTW
AYVQQLKVIDNQRELSRLSRELEP
Download sequence
Identical sequences ENSGGOP00000016046 ENSGGOP00000016046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]