SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016059 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016059
Domain Number 1 Region: 583-662
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.83e-20
Family Complement control module/SCR domain 0.0047
Further Details:      
 
Domain Number 2 Region: 455-535
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.37e-20
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Domain Number 3 Region: 207-269
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000144
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 335-391
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000275
Family Complement control module/SCR domain 0.00064
Further Details:      
 
Domain Number 5 Region: 398-457
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000288
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 6 Region: 275-329
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000813
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 524-580
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000032
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 8 Region: 155-215
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000577
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 9 Region: 92-149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000446
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 10 Region: 26-96
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000354
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016059   Gene: ENSGGOG00000016458   Transcript: ENSGGOT00000016516
Sequence length 663
Comment pep:novel chromosome:gorGor3.1:1:176790071:176818233:-1 gene:ENSGGOG00000016458 transcript:ENSGGOT00000016516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMRLKNLTFIIILIISGELYAEEKPCGFPHVENGRIAQYYYTFKSFYFPMSIDKKLSFFC
LAGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMRYGCA
SGYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELHNGNYSTTQKTFKVKDKVQYE
CATGYYTAGGKKTEEVECLTYGWSLTPKCTKLKCSSLRLIENGYFHPVKQTYEEGDVVQF
FCHENYYLSGSDLIQCYNFGWYPESPVCEEGRRNRCPPPPLPINSKIQTHSTTYRHGEIV
HIECELNFEIHGSEEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLHSKIYYNGD
KVTYACKSGYLLHGLNEITCNHGKWTLPPECVENNENCKHPPVVMNGAVADGLLASYATG
SSVEYRCNEYYLLRGSKISRCEQGKWSSPPVCLEPCTVNVDYMNRNNIEMKWKYEGKVLH
GDLIDFVCKQGYDLSPLTPLSELSVQCNRGEVKYPLCTRKESKGMCTSPPLIKHGVIISS
TVDTYENGSSVEYRCFDHHFLEGSREAYCLEGMWTTPPLCLEPCTLSFAEMEKNNLLLKW
DFDNRPHILHGEYIEFICRGDTYPAELYITGSILRMQCDRGELKYPRCIPRQSSLSYQEP
LRT
Download sequence
Identical sequences ENSGGOP00000016059 ENSGGOP00000016059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]