SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016071 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016071
Domain Number 1 Region: 669-947
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-72
Family Protein kinases, catalytic subunit 0.00000000183
Further Details:      
 
Domain Number 2 Region: 60-232
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.38e-71
Family Ephrin receptor ligand binding domain 0.00000132
Further Details:      
 
Domain Number 3 Region: 357-560
Classification Level Classification E-value
Superfamily Fibronectin type III 3.32e-40
Family Fibronectin type III 0.0000824
Further Details:      
 
Domain Number 4 Region: 963-1030
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.45e-21
Family SAM (sterile alpha motif) domain 0.00051
Further Details:      
 
Domain Number 5 Region: 285-349,395-401
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000648
Family Growth factor receptor domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016071   Gene: ENSGGOG00000016463   Transcript: ENSGGOT00000016529
Sequence length 1035
Comment pep:novel chromosome:gorGor3.1:4:73587795:73935484:-1 gene:ENSGGOG00000016463 transcript:ENSGGOT00000016529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSGPRGAGRRRPPSGGGDTPITPASLAGCYSAPRRAPLWTCLLLCAALRTLLASPSNE
VNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISN
EGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAAD
ESFTELDLGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSVVRHL
AVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNG
TCQVCRPGFFKASPHIQSCGKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMACTRPPSA
PRNAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHARVCEECGGHVRYLPRQSG
LKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAAPSPVTNVKKGKI
AKNSISLSWQEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAEGLKPASVYVFQI
RARTAAGYGVFSRRFEFETTPVFAASSDQSQIPIIAVSVTVGVILLAVVIGVLLSGSCCE
CGCGRASSLCAVAHPSLIWRCGYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDPN
QAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQRRD
FLGEASIMGQFDHPNIIHLEGVVTKSKYDGKLYMSTNISTLSLQKNDGQFTVIQLVGMLR
GISAGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPI
RWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSPMD
CPAALYQLMLDCWQKDRNSRPKFDEIVNMLDKLIRNPSSLKTLVNASCRVSNLLAEHSPL
GSGAYRSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIMNS
LQEMKVQLVNGMVPL
Download sequence
Identical sequences ENSGGOP00000016071 ENSGGOP00000016071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]