SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016199 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016199
Domain Number 1 Region: 384-568
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.25e-17
Family Laminin G-like module 0.026
Further Details:      
 
Domain Number 2 Region: 591-786
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-16
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 3 Region: 115-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000838
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 4 Region: 77-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000069
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 193-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000144
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 6 Region: 270-370
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000157
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 153-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000224
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 8 Region: 777-814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000429
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 9 Region: 43-81
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000429
Family EGF-type module 0.012
Further Details:      
 
Domain Number 10 Region: 1088-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000649
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016199
Domain Number - Region: 817-842
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00429
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 227-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00621
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 1050-1085
Classification Level Classification E-value
Superfamily EGF/Laminin 0.021
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016199   Gene: ENSGGOG00000016601   Transcript: ENSGGOT00000016658
Sequence length 1198
Comment pep:novel chromosome:gorGor3.1:9:106715146:106729365:1 gene:ENSGGOG00000016601 transcript:ENSGGOT00000016658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTVPSEPPSACASDPCAPGTECQATESGGYTCGPMEPRGCATQPCHHGALCVPQGPDPNG
FRCYCVPGFQGPRCELDIDECASRPCHHGATCRNLADRYECHCPLGYAGVTCETEVDECA
SAPCLHGGSCLDGVGSFRCVCAPGYGGTRCQLDLDECQSQPCAHGGTCHDLVNGFRCDCA
GTGYEGTHCELEVLECASAPCAHNASCLEGLGSFRCLCWPGYSGELCEVDEDECASSPCQ
HGGRCLQRSDPALYGGVQAAFPGTFSFGHAAGFLCHCPPGFEGADCGVEVDECASRPCLN
GGHCQDLPNGFQCHCPDGYAGGPTCEEDVDECLSDPCLHGGTCSDTVAGYICRCPETWGG
RDCSVQLTGCQGHTCPLAATCIPIFESGVHSYVCHCPPGTHGPFCGQNTTFSVMAGSPIQ
ASVPAGGPLGLALRFRTTLPAGTLATRNDTKESLELALVAATLQATLWSYGTTVLVLRLS
DLALNDGHWHQVEVVLHLATLELRLWHEGCPARLCVASGPVALASTASATPLPAGISSAQ
LGDATFAGCLQDVRVDGHLLLPEDLGENVLLGCERREQCQPLPCVHGGSCVDLWTHFRCD
CARPHRGPTCADEIPAATFGLGGAPSSASFLLQELPGPNLTVSFLLRTREPAGLLLQFAN
DSAAGLTVFLSEGRIRAEAPGSPAVVLPGRWDDGLRHLVMLSFGPDQLQDLGQHVHVGGR
LLAADSQPWGGPFRGCLQDLRLDGCHLPFFPLPLDNSSQPSELGGRQSWNLTAGCVSEDM
CSPDPCFNGGTCLVTWNDFHCTCPANFTGPTCAQQLWCPGQPCLPPATCEEVPDGFVCEC
VSWAAPVLGAGHLSWLDPICTLRACRILVDQACQAPGQCGGATACRRTEFLEKVSLYWAS
GPDSESHRGKDILWSGIACAKSLWSARTVEVQGGKQEWGGKVELLLPVACDLEGRLGIAP
HPPARAGNCSSMGRKYIGSRSGCVCPTPMGRGVGCECPLGLWWGREVCQVCARTQAQVAH
GHSAGEGRSQVSCTHSSLCSLPRLPVPSKECSLNVTCLDGSPCEGGSPAANCSCLEGLAG
QRCQVPTLPCEANPCLNGGTCRAAGGVSECICNARFSGQFCEVAKGLPLPLPFPLLEVAV
PAACACLLLLLLGLLSGILAARKRRQSEGTYSPSQQEVAGARLEMDSVLKVPPEERLI
Download sequence
Identical sequences ENSGGOP00000016199 ENSGGOP00000025205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]