SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016227 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016227
Domain Number 1 Region: 2279-2543
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-53
Family YWTD domain 0.00000266
Further Details:      
 
Domain Number 2 Region: 518-779
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-43
Family YWTD domain 0.00001
Further Details:      
 
Domain Number 3 Region: 1469-1712
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-38
Family YWTD domain 0.0000182
Further Details:      
 
Domain Number 4 Region: 826-1092
Classification Level Classification E-value
Superfamily YWTD domain 7.72e-37
Family YWTD domain 0.0000923
Further Details:      
 
Domain Number 5 Region: 1145-1415
Classification Level Classification E-value
Superfamily YWTD domain 9.81e-37
Family YWTD domain 0.000031
Further Details:      
 
Domain Number 6 Region: 3135-3406
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-36
Family YWTD domain 0.0000269
Further Details:      
 
Domain Number 7 Region: 418-510,806-820,1090-1141
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000691
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 8 Region: 1815-1856
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000101
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 2224-2272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000159
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 10 Region: 145-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000262
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 2067-2108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000432
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 2707-2746
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000641
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 13 Region: 227-264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000956
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 14 Region: 1937-1976
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000969
Family LDL receptor-like module 0.00059
Further Details:      
 
Domain Number 15 Region: 345-386
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000118
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 16 Region: 2106-2146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 17 Region: 2590-2626
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 18 Region: 2798-2835
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 19 Region: 2149-2189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 20 Region: 2837-2874
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 21 Region: 1779-1822
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000104
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 22 Region: 1984-2019
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000117
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 23 Region: 186-223
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 103-140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 25 Region: 2873-2913
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 26 Region: 2921-2956
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 27 Region: 2665-2709
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 28 Region: 2191-2239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000355
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 29 Region: 309-345
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 30 Region: 266-304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 31 Region: 3006-3042
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 32 Region: 2627-2668
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 33 Region: 1900-1939
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 34 Region: 2962-3000
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 35 Region: 390-426
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000055
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 36 Region: 2023-2066
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 37 Region: 2761-2794
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 38 Region: 3087-3121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000359
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 39 Region: 3461-3494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000381
Family EGF-type module 0.02
Further Details:      
 
Domain Number 40 Region: 1863-1897
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000825
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016227
Domain Number - Region: 3049-3088
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000106
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 1421-1465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000209
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 780-826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00028
Family EGF-type module 0.0093
Further Details:      
 
Domain Number - Region: 59-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00244
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 2548-2609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 3415-3440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0111
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 1734-1794
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0183
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016227   Gene: ENSGGOG00000016592   Transcript: ENSGGOT00000016686
Sequence length 3735
Comment pep:novel chromosome:gorGor3.1:2b:56913564:57033898:-1 gene:ENSGGOG00000016592 transcript:ENSGGOT00000016686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFSEHLFFTDWRLGAIIRVRKADGGEMTVIRSGIAYILHLKSYDVNIQAGSNACNQPTHP
NGDCSHFCFPVPNFQRVCGCPYGMRLASNHLTCEGDPTNEPPTEQCGLFSFPCKNGRCVP
NYYRCDGVDDCHDNSDEQLCGTLNNTCSSSAFTCGHGECIPAHWRCDKRNDCVDGSDEHN
CPTHAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDEKNCNSTETCQPSQFNCPNHR
CIDLSFVCDGDKDCVDGSDEVGCVLNCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEA
GCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDN
GNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPN
GTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCEDIDECDILGSC
SQHCYNMRGSFRCSCDTGYMLESDGRTCKVTASESLLLLVASQNKIIADSVTSQVHNIYS
LVENGSYIVAVDFDSISGRIFWSDATQGKTWSAFQNGTDRRVVFDSSIILTETIAIDWVG
RNLYWTDYALETIEVSKIDGSHRTVLISKNLTNPRGLALDPRMNEHLLFWSDWGHHPRIE
RASMDGSMRTVIVQDKIFWPCGLTIDYPNRLLYFMDSYLDYMDFCDYNGHHRRQVIASDL
IIRHPYALTLFEDSVYWTDRATRRVMRANKWHGGNQSVVMYNIQWPLGIVAVHPSKQPNS
VNPCAFSRCSHLCLLSSQGPHFYSCVCPSGWSLSPDLLNCLRDDQPFLITVRQHIIFGIS
LNPEVKSNDAMVPIAGIQNGLDVEFDDAEQYIYWVENPGEIHRVKTDGTNRTVFASISMV
GPSMNLALDWISRNLYSTNPRTQSIEVLTLHGDIRYRKTLIANDGTALGVGFPIGITVDP
ARGKLYWSDQGTDSGVPAKIASANMDGTSVKTLFTGNLEHLECVTLDIEEQKLYWAVTGR
GVIERGNVDGTDRMILVHQLSHPWGIAVHDSFLYYTDEQYEVIERVDKATGANKIVLRDN
VPNLRGLQVYHRRNAAESSNGCSNNMNACQQICLPVPGGLFSCACATGFKLNPDNRSCSP
YNSFIVVSMLSAIRGFSLELSDHSETMVPVAGQGRNALHVDVDVSSGFIYWCDFSSSVAS
DNAIRRIKPDGSSLMNIVTHGIGENGVRGIAVDWVAGNLYFTNAFVSETLIEVLRINTTY
RRVLLKVTVDMPRHIVVDPKNRYLFWADYGQRPKIERSFLDCTNRTVLVSEGIVTPRGLA
VDRSDSYVYWVDDSLDIIARIRINGENSEVIRYGSRYPTPYGITVFENSIIWVDRNLKKI
FQASKEPENTEPPTVIRDNINWLRDVTIFDKQVQPRSPAEVNNNPCLENNGGCSHLCFAL
PGLYTPKCDCAFGTLQSDGKNCAISTENFLIFALSNSLRSLHLDPENHSPPFQTINVERT
VMSLDYDSVSDRIYFTQNLASGVGQISYATLSSGIHTPTVIASGIGTADGIAFDWITRRI
YYSDYLNQTINSMAEDGSNRTVIARVPKPRAIVLDPCQGYLYWADWDTHAKIERATLGGN
FRVPIVNSSLVMPSGLTLDYEEDLLYWVDASLQRIERSTLTGVDREVIVNAAVHAFGLTL
YGQYIYWTDLYTQRIYRANKYDGSGQIAMTTNLLSQPRGINTVVKNQKQQCNNPCEQFNG
GCSHICAPGPNGAECQCPHEGNWYLANNRKHCIVDNGERCGASSFTCSNGRCISEEWKCD
NDNDCGDGSDEMESVCALHTCSPTAFTCANGRCVQYSYRCDYYNDCGDGSDEAGCLFRDC
NATTEFMCNNRRCIPREFICNGVDNCHDNNTSDEKNCPDRTCQSGYTKCHNSNICIPRVY
LCDGDNDCGDNSDENPTYCTTHTCSSSEFQCTSGRCIPQHWYCDQETDCFDASDEPASCG
HSERTCLADEFKCDGGRCIPSEWICDGDNDCGDMSDEDERHQCQNQNCSDSEFLCVNDRP
PDRRCIPQSWVCDGDVDCTDGYDENQNCTRRTCSENEFTCGYGLCIPKIFRCDRHNDCGD
YSDERGCLYQTCQQNQFTCQNGRCISKTFVCDEDNDCGDGSDELMHLCHTPEPTCPPHEF
KCDSGRCIEMMKLCNHLDDCLDNSDEKGCGINECHDPSISGCDHNCTDTLTSFYCSCRPG
YKLMSDKRTCVDIDECTEMPFVCSQKCENVIGSYICKCAPGYLREPDGKTCRQNSNIEPY
LIFSNRYYLRNLTIDGYFYSLILEGLGNVVALDFDRVEKRLYWIDTQRQVVERMFLNKTN
KETIINHRLPAAESLAVDWVSRKLYWLDARLDGLFVSDLNGGHRRMLAQHCVDANNTFCF
DNPRGLALHPQYGYLYWADWGHRAYIGRVGMDGTNKSVIISTKLEWPNGITIDYTNDLLY
WADAHLGYIEYSDLEGHHRHTVYDGALPHPFAITIFEDTIYWTDWNTRTVEKGNKYDGSN
RQTLVNTTHRPFDIHVYHPYRQPIVSNPCGTNNGGCSHLCLIKPGGKGFTCECPDDFRTL
QLSGSTYCMPMCSSTQFLCANNEKCIPIWWKCDGQKDCSDGSDELALCPQRFCRLGQFQC
NDGNCTSPQTLCNAHQNCPDGSDEDRLLCENHHCDSNEWQCANKRCIPESWQCDTFNDCE
DNSDEDSSHCASRTCRPGQFRCANGRCIPQAWKCDVDNDCGDHSDEPIEECMSSAHLCDN
FTEFSCKTNYRCIPKWAVCNGVDDCRDNSDEQGCEERTCHPVGDFRCKNHHCIPLRWQCD
GQNDCGDNSDEENCAPRECTESEFRCVNQQCIPSRWICDHYNDCGDNSDERDCEMRTCHP
EYFQCTSGHCVHSELKCDGSADCLDASDEADCPTRFPDGAYCQATTFECKNHVCIPPYWK
CDGDDDCGDGSDEELHLCLDVPCNSPNRFRCDNNRCIYSHEVCNGVDDCGDGTDETEEHC
RKPTPKPCTEYEYKCGNGHCIPHDNVCDDADDCGDWSDELGCNKGKERTCAENICEQNCT
QLNEGGFICSCTAGFETNVFDRTSCLDINECEQFGTCPQHCRNTKGSYECVCADGFTSMS
DRPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYLQDEEYIQAVDYDWDPEDIGLSV
VYYTVRGEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLKYIMQPDGIAVDWVGRHIYWSD
VKNKRIEVAKLDGRYRKWLISTDLDQPAAIAVNPKLGLMFWTDWGKEPKIESAWMNGEDR
NILVFEDLGWPTGLSIDYLNNDRIYWSDFKEDVIETIKYDGTDRRVIAKEAMNPYSLDIF
EDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRIFHQLRYNKSVPNLCKQICSH
LCLLRPGGYSCACPQGSSFIEGSTTECDAAIELPINLPPPCRCMHGGNCYFDETDLPKCK
CPSGYTGKYCEMAFSKGISPGTTAVAVLLTILLIVIIGALAIAGFFHYRRTGSLLPALPK
LPSLSSLVKPSENGNGVTFRSGADLNMDIGVSGFGPETAIDRSMAMSEDFVMEMGKQPII
FENPMYSARDSAVKVVQPIQVTVSENVDNKNYGSPINPSEIVPETNPTSPAADGTQVTKW
NLFKRKAKQTTNFENPIYAQMENEQKESVAATPPPSPSLPAKPKPPSRRDPTPTYSATED
TFKDTANLVKEDSEV
Download sequence
Identical sequences ENSGGOP00000016227 ENSGGOP00000016227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]