SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016260 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016260
Domain Number 1 Region: 1-173
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000000586
Family FCH domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016260   Gene: ENSGGOG00000016658   Transcript: ENSGGOT00000016719
Sequence length 259
Comment pep:novel chromosome:gorGor3.1:16:75661109:75672316:-1 gene:ENSGGOG00000016658 transcript:ENSGGOT00000016719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSQVRVMENTVANTEKYFGQFCSLLAAYTRKTARLRDKADQLVKQLIDFANSENPELRAT
MRGFAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNLEIKQLEK
LEKLRQKSPSDQQMISQAETRVQRAAVDSSRTTLQLEETVDAFQRQKLKDLQDFRAKMQG
VYGHHDTRLLANTNPSPSVLQSLASQGTLQVQLSRANEDPEHPHANHGRFSLCECVVKGQ
PAHCVCGQGGHLMLPGLSL
Download sequence
Identical sequences ENSGGOP00000016260 ENSGGOP00000016260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]