SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016369 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016369
Domain Number 1 Region: 332-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000103
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 2 Region: 970-1022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000949
Family Laminin-type module 0.0039
Further Details:      
 
Domain Number 3 Region: 817-865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number 4 Region: 265-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 5 Region: 863-913
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 6 Region: 506-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 7 Region: 923-972
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000019
Family Laminin-type module 0.052
Further Details:      
 
Domain Number 8 Region: 455-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000022
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 9 Region: 414-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 10 Region: 1080-1122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 11 Region: 769-819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000893
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 12 Region: 1128-1175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 13 Region: 1022-1077
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016369
Domain Number - Region: 1568-1758
Classification Level Classification E-value
Superfamily Tropomyosin 0.017
Family Tropomyosin 0.013
Further Details:      
 
Domain Number - Region: 104-159
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0468
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016369   Gene: ENSGGOG00000016757   Transcript: ENSGGOT00000016833
Sequence length 1761
Comment pep:novel chromosome:gorGor3.1:7:105705375:105813141:-1 gene:ENSGGOG00000016757 transcript:ENSGGOT00000016833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFQLTLFLHLGWLSYSKAQDDCNRGACHPTTGDLLVGRNTQLTASSTCGLSRAQKYCIL
SYLEGEQKCFICDSRFPYDPYEQPNSHTIENVIVSFEPDREKKWWQSENGLDHVSIRLDL
EALFRFSHLILTFKTFRPAAMLVERSTDYGHNWKVFKYFAKDCATSFPNITSGQAQGVGD
IVCDSKYSDIEPSTGGEVVLKVLDPSFEIENPYSPYIQDLVTLTNLRINFTKLHTLGDTL
LGRRQNDSLDKYYYALYEMIVRGSCFCNGHASECRPMQKMRGDVFSPPGMVHGQCVCQHN
TDGPNCERCKDFFQDAPWRPAADLQDNACRSCSCNSHSSRCHFDMTTYLASGGLSGGVCE
DCQHNTEGQHCDRCRPLFYRDPLKTISDPYACIPCECDPDGTISGGICVSHSDPALGSVA
GQCLCKENVEGAKCDQCKPNHYGLSATDPLGCQPCDCNPLGSLPFLTCDVDTGQCLCLSY
VTGAHCEECTVGYWGLGNHLHGCSPCDCDIGGAYSNVCSPKNGQCECRPHVTGHSCSEPA
PGYFFAPLNFYLYEAEEAAPLQGLAPLGSETFGQSPAVHVVLGEPVPGNPVTWTGPGFAR
VLPGAGLRFAVNNIPFPVDFTIAIRYETQSAADWTVQIVVNPPGGSEHCIPKTLQSKPQS
FALPAATRIMLLPTPICLEPDVQYSIDVYFSQPLQGESHAHSHVLVDSLGLIPQINSLEN
FCSKQDLDEYQLHNCFEIASATGPQVLPGACERLIISMSAKLHDGAVACKCHPQGSVGSS
CSRLGGQCQCKPLVVGRCCDRCSTGSYDLGHHGCHPCHCHPQGSKDTVCDQVTGQCPCHG
EVSGRRCDRCLAGYFGFPSCHPCPCNGFAELCDPETGSCFNCGGFTTGRNCERCIDGYYG
NPSSGQPCRPCLCPDDPSSNQYFAHSCYQNPWSSEVICNCLQGYTGTQCGECSTGFYGNP
RISGAPCRPCACNNNIDVTDPESCSWVTGECLRCLHNTQGTNCQLCKPGHYGSALNQTCR
RCSCHASGVSPMECPPGGGACLCDPVTGACPCLPNVTGLVCDRCADGYWNLVPGRGCQSC
DCDPRTSQSSHCDQLTGQCPCKLGYGGKHCSECQENYYGDPPGRCIPCDCNRAGTQKPIC
DPDTGMCHCREGVSGQRCDRCARGHSQEFPTCLQCHLCFDQWDHTISSLSKVVQGLMRLA
ANMEDKRETLPVCEADFKDLRGNVSEIERILKHPVFPSGKFLKVKDYHDSVRKQIMQLNE
QLKAVYEFQDLKDTIERAKNEADLLLEDLQEEIDLQSSVLNASIVDSSENIKKYYHISSS
AEKKINETSSTINTSANTRNDLLTILDTLTSKGNLSLERLKQIKIPDIQILNEKVCGDPG
NVPCVPLPCGGALCTGRKGHRKCRGPGCHGSLTLSTNALQKAQEAKSIIRNLDKQVRGLK
NQIESISELAEVSKNNALQLREKLGNIRNQSDSEEENINLFIKKVKNFLLEENVPPEDIE
KVANGVLDIHLPIPSQNLTDELDKIQKCMQLCEDYRTDENRLNEEADGAQKLLVKAKAAE
KAANILLNLDKTLNQLQQAQITQGRANSTITQLTANITKIKKNVLQAENQTREMKSELEL
AKQRSGLEDGLSLLQTKLQRHQDHAVNAKVQAESAQHQAGSLEKEFVELKKQYAVLQRKT
STTGLTKETLGKVKQLKDAAEKLAGDTEAKIRRITDLERKIQDLNLSRQAKADQLRILED
QVVAIKNEIVEQEKKYATCYS
Download sequence
Identical sequences G3RKT7
XP_004046095.1.27298 XP_018886141.1.27298 ENSGGOP00000016369 ENSGGOP00000016369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]