SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016411 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016411
Domain Number 1 Region: 137-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000526
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 55-176
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000148
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016411   Gene: ENSGGOG00000016820   Transcript: ENSGGOT00000016876
Sequence length 273
Comment pep:novel chromosome:gorGor3.1:9:120301606:120311213:1 gene:ENSGGOG00000016820 transcript:ENSGGOT00000016876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHR
ACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQP
GRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKG
GPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLL
VHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
Download sequence
Identical sequences A0A024R8F5 G3RKX9 Q9UHF1
ENSGGOP00000016411 ENSP00000307843 ENSP00000360763 ENSP00000360764 ENSP00000385639 ENSP00000307843 9606.ENSP00000307843 NP_057299.1.87134 NP_057299.1.92137 NP_958854.1.87134 NP_958854.1.92137 XP_004048938.1.27298 XP_004048939.1.27298 XP_011517066.1.92137 XP_011517067.1.92137 XP_011517068.1.92137 ENSP00000307843 ENSP00000360763 ENSP00000360764 ENSP00000385639 gi|41393583|ref|NP_958854.1| gi|7705889|ref|NP_057299.1| ENSGGOP00000016411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]