SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016453 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016453
Domain Number 1 Region: 334-405
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.96e-22
Family Intermediate filament protein, coiled coil region 0.0014
Further Details:      
 
Domain Number 2 Region: 94-129
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000131
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Domain Number 3 Region: 12-71,404-448
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000001
Family Growth factor receptor domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016453
Domain Number - Region: 207-321
Classification Level Classification E-value
Superfamily Prefoldin 0.00288
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016453   Gene: ENSGGOG00000016863   Transcript: ENSGGOT00000016918
Sequence length 448
Comment pep:novel chromosome:gorGor3.1:5:42641897:42649845:1 gene:ENSGGOG00000016863 transcript:ENSGGOT00000016918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSCCVTNNLQASLKSCPRPASVCSSGVNCRPELCLGYVCQPMACLPSVCMPTTFRPAS
CLSKTYLSSSCRAASGISGSMGTGSWYSEGAFNGNEKETMQFLNDRLASYLTRVRQLEQE
NVELESRIQEASHSQVLTMTPDYQSHFRTIEELQQKILCTKAENARMVVNIDNAKLAADD
FRAKYEAELAMRQLVEADINGLRRILDDLTLCKADLEAQVESLKEELMCLKKNHEEEVGS
LRCQLGDHLNIEVDAAPPVDLTRVLEEMRCQYEAMVEANRRDVEEWFNMQMEELNQQVAT
SSEQLQNYQSDIIDLRRTVNTLEIELQAQHSLRDSLENTLTESEARYSSQLAQMQCMITN
VEAQLAEIRADLERQNQEYQVLLDVRARLEGEINTYRSLLESEDCKLPCNPCSTPSCTTC
VPSPCVPRTVCVPRTVGVPCSPCPQGHY
Download sequence
Identical sequences G3RL19
ENSGGOP00000016453 ENSGGOP00000016453 XP_004041729.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]