SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016459 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016459
Domain Number 1 Region: 325-402
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 6.28e-23
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 95-129
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000251
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Domain Number 3 Region: 208-323
Classification Level Classification E-value
Superfamily Prefoldin 0.000034
Family Prefoldin 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016459   Gene: ENSGGOG00000016868   Transcript: ENSGGOT00000016924
Sequence length 455
Comment pep:novel chromosome:gorGor3.1:5:42625608:42629923:1 gene:ENSGGOG00000016868 transcript:ENSGGOT00000016924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKCLKAGFSSGSLKSPGGASGGSTRVSAMYSSSSCKLPSLSRVARSFSACSVGLGRSS
YRATSCLPTLCLPAGGFTTSYSVGGGWFGEGILTGNEKETMQSLNDRLASYLEKVRQLEQ
ENASLESRIREWCEQQVPYMCPDYQSYFRTIEELQKKTLCSKAENARLVVEIDNAKLAAD
DFRTKYEMEVSLRQLVESDINGLRRILDDLTLCKSDLEAQVESLKEELLCLKKNHEEEVN
SLRCQLGDRLNVEVDAAPPVDLNRVLEEMRCQYETLVENNRRDAEDWFDTQSEELNQQVV
SSSEQLQSCQAEIIELRRTVNALEIELQAQHSMRDALESTLAETEARYSSQLAQMQCMIT
NMEAQLAEIRADLERQNQEYQVLLDVRARLECEINTYRGLLESEDSKLPCNPCAPDYSPS
KSCLPCLPAASCGPSAARTNCSPRPICVPCPGGRF
Download sequence
Identical sequences G3RL24
ENSGGOP00000016459 XP_004041730.1.27298 ENSGGOP00000016459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]