SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016472 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016472
Domain Number 1 Region: 333-411
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.62e-25
Family Intermediate filament protein, coiled coil region 0.0012
Further Details:      
 
Domain Number 2 Region: 102-136
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000214
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016472
Domain Number - Region: 200-329
Classification Level Classification E-value
Superfamily Prefoldin 0.000288
Family Prefoldin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016472   Gene: ENSGGOG00000016882   Transcript: ENSGGOT00000016937
Sequence length 458
Comment pep:novel chromosome:gorGor3.1:5:42600633:42605261:1 gene:ENSGGOG00000016882 transcript:ENSGGOT00000016937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLRLQSSSASYGGGFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCGFGGGAGSG
FGGGYGGGLGGGYGGGLGGGFGGGFAGGFVDFGACDGGLLTGNEKITMQNLNDRLASYLE
KVRALEEANADLEVKIRDWHLKQSPASPERDYSPYYKTIEELRDKILTATIENNRVILEI
DNGRLAADDFRLKYENELALRQSVEADINGLRRVLDELTLSKTDLEMQIESLNEELAYMK
KNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHAKS
AELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQL
QQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFP
SSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP
Download sequence
Identical sequences G3RL36
ENSGGOP00000016472 XP_004041722.1.27298 ENSGGOP00000016472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]