SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016590 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000016590
Domain Number - Region: 56-117
Classification Level Classification E-value
Superfamily Prefoldin 0.00288
Family Prefoldin 0.026
Further Details:      
 
Domain Number - Region: 71-205
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0722
Family BAR domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016590   Gene: ENSGGOG00000016999   Transcript: ENSGGOT00000017056
Sequence length 256
Comment pep:novel chromosome:gorGor3.1:15:8990631:8997590:1 gene:ENSGGOG00000016999 transcript:ENSGGOT00000017056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKEYWQKNSPRVPAGTNRNRKTNGSIPETATSGGCQPPGDSATGFHREGPTSSATLKDLE
SPCQELAAVLDSRSAEITQLKNTIKSLVYTLKTEKEHYTHRVEELERSLSELKNQMAEPL
PPEPPAVPSEVELQHLRKELERVAGELQAQVKNNQHISLLNRRQEERIREQEERLRKQEE
RLQEQHEKLQQLAKPQSVFEEPNNENKSALQLEQQVKELQEKLGEVKETENLTPSKKGWE
AGSSLLGGEGPGQRQV
Download sequence
Identical sequences ENSGGOP00000016590 ENSGGOP00000016590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]