SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016688 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016688
Domain Number 1 Region: 138-288
Classification Level Classification E-value
Superfamily L domain-like 1.12e-22
Family Internalin LRR domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016688   Gene: ENSGGOG00000017099   Transcript: ENSGGOT00000017158
Sequence length 662
Comment pep:novel chromosome:gorGor3.1:12:122051023:122072059:1 gene:ENSGGOG00000017099 transcript:ENSGGOT00000017158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASYESESESESEAGPGTQRPGTGTVSAAVREHLRKLCLREFPCGAGSWNKSRFLPQTW
RTWRELVPREEVVVSPGEETVEALLGLVRSRHSPWALLNNSNAEDSFLRESAIRNPLTIT
DTFFYSYFRSLRVVDQEVTLVDKDLLKFLKLEELVLSANRIKEVDATNLPPTLKVLELYG
NEISSMECLCARPPASLQHLGLGRNKLLGPLESLYVTANHWPNLISLDLGFNDLTDLQSM
VTSLRTLRHLRLLVLQGNPLALVPYYRGLAIDSLAQLCVLDDITVSPNEKHLFRGLSLNG
DLLAQEAQFVVTIGNIRGVLDTSVLDPEPGPEGPFITYNYYVTYDFVKDEEGEMNESAGV
LAEIVKPSPSLELLVEESPEEVVEDVIEDIVEEVTEGVEGSLESEVEESGESELSVISGP
STILQTPRASAEELAKLRLRIDPRLCPSPGTVLFSTAHKPWAEVIPCSYEMQHSLRDLVP
LKAFLLAGTTVTIVEEKILSWPVVLPAVDSPLSESRPRYRALVLGRAAWPHPCFNLSHPP
VLLSSQEWKVPKKKKEPPKELWQDPPILQVLGRGLVILEPLLAGEPLVSTVCNFGVVRTL
TSDRLTLARDSKKIKKVAKKEKPKAVIPIYEGDYHPEPLTVEVQIQLNQCRSAEEALRMF
AV
Download sequence
Identical sequences ENSGGOP00000016688 ENSGGOP00000016688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]