SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016717 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016717
Domain Number 1 Region: 298-466,569-822
Classification Level Classification E-value
Superfamily Ras GEF 1.31e-104
Family Ras GEF 0.00014
Further Details:      
 
Domain Number 2 Region: 474-578
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.4e-30
Family Ras-binding domain, RBD 0.00000739
Further Details:      
 
Domain Number 3 Region: 30-150
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.75e-28
Family DEP domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016717   Gene: ENSGGOG00000017128   Transcript: ENSGGOT00000017188
Sequence length 823
Comment pep:novel chromosome:gorGor3.1:7:22353421:22551179:-1 gene:ENSGGOG00000017128 transcript:ENSGGOT00000017188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLEADCDTLSRRISNPYLEHTPSQIYGENSSCAGRALRNIIIVQAADLIKDRVNLKGFYR
RSCVGSELVDWLLEHCPFVQCRSMAIGVWQLLLDMGIMLSVDQHLYFQDTYVFYQFSSDE
CSYLYCEFEREEEWQNGVKLLLQLVPLIPARGGICELSHQKIEDSEESSDEILVRLTSAV
QRELAAVIALKARKSAIEQDEENNDKHVAVTEAESVPDSQAGVMCKLQERDEIGRIELVQ
KLAKENYQFLQTDKKEQEKSEHQDDEVTTVQVKEQDQSVLVLKKVQCCGPAPTAGSAESH
WRYVVVSGTPEKILEHLLNDLHLEEVQDKETETLLDDFLLTYTVFMTTDDLCQALLRMGR
HSICTYSAKKYQGKEENSDVPRRKRKVLHLVSQWIALYKDWLHEDEHSKMFLKTIYRNVL
DDVYEYPILEKELKEFQKILGMHRRHTVDEYSPQKKNKALFHQFSLKENWLQHRGTVTET
EEIFCHVYITEHSYVSVKAKVSSIAQEILKVVAEKIQYAEEDLALVAITFSGDKEKHELQ
PNDLVISKSLEASGRIYVYRKDLADTLNPFAENEESQQRSMRILGMNTWDLALELMNFDW
SLFNSIHEQELIYFTFSRQGSGEHTANLSLLLQRCNEVQLWVATEILLCSQLGKRVQLVK
KFIKIAAHCKAQRNLNSFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFSELESLTDPSLN
HKAYRDAFKKMKPPKIPFMPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRTLRHCR
TNQFGSDLSPKEHQELKSYVNHLYVIDSQQALFELSHRIEPRV
Download sequence
Identical sequences ENSGGOP00000020894 ENSGGOP00000016717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]