SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016727 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016727
Domain Number 1 Region: 102-187
Classification Level Classification E-value
Superfamily E set domains 0.000000000867
Family Filamin repeat (rod domain) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016727
Domain Number - Region: 448-550
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.0513
Family Putative acetylxylan esterase-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016727   Gene: ENSGGOG00000017141   Transcript: ENSGGOT00000017198
Sequence length 559
Comment pep:novel chromosome:gorGor3.1:3:100826517:100878426:1 gene:ENSGGOG00000017141 transcript:ENSGGOT00000017198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTNFFKLRLFCCLLAVLMVVVLVINVTQVEYLDHETVSATFIDSSGQFVSSQVTGISRN
PYCGYDQQTLSSQERMEEDSLLAALHRQVPDVGPVPFVKSTDPSSSYFVILNSAAFFKVG
SQLEVLVHVQDFQRKPKKYGGDYLQARIHSPKLQAGAVGRVVDYQNGFYKVFFTLLWPGK
VKVSVSLVHPSEGIRVLQRLQEDKPDRVYFKSLFRSGRISETTECNVCLPGNLPLCNFTD
LYTGEPWFCFKPKKLPCSSRITHFKGGYLKGLLTAAESAFFQSGVNIKMPVNSSGPDWVT
VIPRRIKETNSLELSQGSGTFPSGYYYKDQWRPRKFKMRQFNDPDNITECLQRKVVHLFG
DSTIRQWFEYLTTFVPDLVEFNLGSPKNVGPFLAVDQKHNILLKYRCHGPPIRFTTVFSN
ELHYVANELNGIVGGKNTVVAIAVWSHFSTFPLEVYIRRLRNIRRAVVRLLDRSPKTVVV
IRTANAQELGPEVSLFNSDWYNFQLDTILRRMFSGVGVYLVDAWEMTLAHYLPHKLHPDE
VIVKNQLDMFLSFVCPLET
Download sequence
Identical sequences A0A2I2Y9F5
ENSGGOP00000016727 ENSGGOP00000016727 XP_004036050.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]