SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016822 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016822
Domain Number 1 Region: 266-325
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000000192
Family Intermediate filament protein, coiled coil region 0.0019
Further Details:      
 
Domain Number 2 Region: 46-71
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000387
Family Intermediate filament protein, coiled coil region 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016822   Gene: ENSGGOG00000025433   Transcript: ENSGGOT00000031787
Sequence length 335
Comment pep:novel chromosome:gorGor3.1:2b:92294090:92295186:-1 gene:ENSGGOG00000025433 transcript:ENSGGOT00000031787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASVYAGPGSSGSWISMSRSTSFRGGLGSRGVAAGMAGGLAGMGGIQNEKETMQSLNDRLA
SYLDRVRSLRWETGLESKIWEHLEKKGPQTIEEDLTQIFTSTVDNTRIILQIDNAHLAAD
DFRVKYETEPATCQSVENDIHGLHKVIDDTSVTQLQLETEIEALKEELLFLKKNHEEEVK
GLQAQIASSLTVEVDAPKSQDLAKIMADIQAQYNELTQKNIEESTTVVTTQSAEVGAAVM
MLTELRHTVQALEIDLHWMKNLEASLENSLKMEQLNGILLHLESELAQTRAEGQGQAQEY
QALPNIKVKLEAEIATYRRLLEDGEDFNFGDALDS
Download sequence
Identical sequences ENSGGOP00000016822 ENSGGOP00000016822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]