SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016855 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016855
Domain Number 1 Region: 230-298
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000000366
Family Intermediate filament protein, coiled coil region 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016855
Domain Number - Region: 2-33
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000136
Family Intermediate filament protein, coiled coil region 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016855   Gene: ENSGGOG00000024111   Transcript: ENSGGOT00000025163
Sequence length 341
Comment pep:novel chromosome:gorGor3.1:15:68735950:68736998:1 gene:ENSGGOG00000024111 transcript:ENSGGOT00000025163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKGNMQGLNDCLVSHLDRVRSLQTKNQRLKSKIWKHLAEGTPGQRLGALLQDHQEPKGSD
NSVDNACIIFQVENARLAADDFRVKYETQLAMRQSVESDIHEICEVVDVTWLQPETEIKA
LKEELLFMEKNREEEVKDLQAQIASCGLIMEVDAPRSRYISKIRADIQSQYDELAQKNRE
ELDKYWSQQTEEGTTVVTTQSAVHGAAKMMLTELRHTLQSLEIDLDSISKASLENSLRVV
EVHYTMQREQLNGVLLHLESELAQTQTEGQHQTQEYEALMNIKVKPEAEFTTYHCLLEDR
EDFSLGDALDSSNSIQTIQKSTIGRLVDGKVGSETNDTKVL
Download sequence
Identical sequences ENSGGOP00000016855 ENSGGOP00000016855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]