SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016889 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016889
Domain Number 1 Region: 28-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000518
Family Growth factor receptor domain 0.0026
Further Details:      
 
Domain Number 2 Region: 193-238
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000536
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016889   Gene: ENSGGOG00000024218   Transcript: ENSGGOT00000027221
Sequence length 251
Comment pep:novel chromosome:gorGor3.1:20:42488327:42508754:1 gene:ENSGGOG00000024218 transcript:ENSGGOT00000027221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGTPKTHLLAFSLLCLLSKVCTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRL
GEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIR
CGYQDPGTHQKLGGAEAEEGEWRVSRPPSLKPINKKPPPLRCGDRAGRGKAGHPLPPLGP
QFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPP
SRGRSPQNSAF
Download sequence
Identical sequences ENSGGOP00000028424 ENSGGOP00000016889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]