SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016950 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016950
Domain Number 1 Region: 232-274
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000288
Family Spermadhesin, CUB domain 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016950
Domain Number - Region: 557-592
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0628
Family Spermadhesin, CUB domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016950   Gene: ENSGGOG00000021963   Transcript: ENSGGOT00000022462
Sequence length 836
Comment pep:novel chromosome:gorGor3.1:3:46245575:46313187:-1 gene:ENSGGOG00000021963 transcript:ENSGGOT00000022462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLNCGVSIALLGVLLLGAARLPRGAEAFEIALPRESNITVLIKLGTPTLLAKPCYIVI
SKRHITMLSIKSGERIVFTFSCQSPENHFVIEIQKNIDCMSGPCPFGEVQLQPSTSLLPT
LNRTFIWDVKAHKSIGLELQFSIPRLRQIGPGESCPDGVTHSISGRIDATVVRIGTFCSN
GTVSRIKMQEGVKMALHLPWFHPRNVSGFSIANRSSIKRLCIIESVFEGEGSATLMSANY
PEGFPEDELMTWQFVVPAHLRASVSFLNFNLSNCERKEERVEYYIPGSTTNPEVFKLEDK
QPGNMAGNFNLSLQGCDQDAQSPGILRLQFQVLVQHPQNESNKIYVVDLSNERAMSLTIE
PQPVKQSRKFVPGCFVCLESRTCSSNLTLTSGSKHKISFLCDDLTRLWMNVEKTISCTDH
RYCQRKSYSLQVPSDILHLPVELHDFSWKLLVPKDRLSLVLVPAQKLQQHTHEKPCNTSF
SYLVASAIPSQDLYFGSFCPGGSIKQIQVKQNISVTLRTFAPSFRQEASRQGLTVSFIPY
FKEEGVFTVTPDTKSKVYLRTPNWDRGLPSLTSVSWNISVPRDQVACLTFFKERSGVVCQ
TGRAFMIIQEQRTRAEEIFSLDEDVLPKPSFHHHSFWVNISNCSPTSGKQLDLLFSVTLT
PRTVDLTVILIAVVGGGALLLSALGLIICCVKKKKKKTNKGPAVGIYNGNINTEMPRQPK
KFQKGRKDNDSHVYAVIEDTMVYGHLLQDSGGSFLQPEVDTYRPFQGTMGVCSPSPPTIC
SRAPTAKLATEEPPPCSPPESESEPYTFSHPNNGDVSSKDTDIPLLNTREPMEPAE
Download sequence
Identical sequences ENSGGOP00000016950 ENSGGOP00000016950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]