SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017044 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017044
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.67e-57
Family Cofilin-like 0.000000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017044   Gene: ENSGGOG00000023183   Transcript: ENSGGOT00000027491
Sequence length 166
Comment pep:novel chromosome:gorGor3.1:11:62728193:62731657:-1 gene:ENSGGOG00000023183 transcript:ENSGGOT00000027491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV
GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
Download sequence
Identical sequences A0A2I3GTS7 A0A2J8TZL9 A0A2K5DRT6 A0A2K6TI94 F7DXG8 F7GPI9 G3RMM9 H2Q279 I3MY03 P23528 V9HWI5
ENSCJAP00000003440 ENSGGOP00000017044 ENSPTRP00000004744 ENSCJAP00000003472 ENSGGOP00000017044 ENSPTRP00000004744 ENSNLEP00000007082 ENSNLEP00000007082 ENSPVAP00000015993 000006799|e1q8gA1|224.1.1.1|A:1-166 000077901|e1q8xA1|224.1.1.1|A:1-166 000184302|e3j0sM1|224.1.1.1|M:1-166 000436236|e3j0sO1|224.1.1.1|O:1-166 000436237|e3j0sN1|224.1.1.1|N:1-166 000436238|e3j0sQ1|224.1.1.1|Q:1-166 000436239|e3j0sP1|224.1.1.1|P:1-166 000436240|e3j0sS1|224.1.1.1|S:1-166 000436241|e3j0sR1|224.1.1.1|R:1-166 000436242|e3j0sU1|224.1.1.1|U:1-166 000436243|e3j0sT1|224.1.1.1|T:1-166 000436244|e3j0sW1|224.1.1.1|W:1-166 000436245|e3j0sV1|224.1.1.1|V:1-166 000436246|e3j0sX1|224.1.1.1|X:1-166 cath|current|1q8gA00/1-166 cath|current|1q8xA00/1-166 d1q8ga_ d1q8xa_ ENSECAP00000017389 gi|5031635|ref|NP_005498.1| 1q8gA 9598.ENSPTRP00000004744 9606.ENSP00000309629 9796.ENSECAP00000017389 ENSECAP00000017389 1q8g_A 1q8x_A 3j0s_M 3j0s_N 3j0s_O 3j0s_P 3j0s_Q 3j0s_R 3j0s_S 3j0s_T 3j0s_U 3j0s_V 3j0s_W 3j0s_X ENSP00000309629 ENSP00000432660 ENSPVAP00000015993 399909 NP_005498.1.87134 NP_005498.1.92137 XP_001494584.1.31192 XP_002916677.1.58354 XP_003274255.1.23891 XP_004437680.1.5094 XP_004618483.1.94378 XP_006101632.1.53796 XP_006771640.1.95426 XP_008531143.1.77740 XP_008707230.1.72690 XP_008952328.1.60992 XP_009421771.1.37143 XP_010346634.1.74449 XP_012318375.1.9421 XP_014700305.1.49734 XP_015358605.1.40921 XP_016063879.1.3490 XP_018891644.1.27298 XP_019500817.1.44202 XP_021587455.1.77405 XP_533231.1.84170 ENSP00000309629 ENSP00000432660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]