SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017071 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017071
Domain Number 1 Region: 281-348
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000448
Family UBX domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017071   Gene: ENSGGOG00000012833   Transcript: ENSGGOT00000030989
Sequence length 412
Comment pep:novel chromosome:gorGor3.1:10:56815427:56838489:1 gene:ENSGGOG00000012833 transcript:ENSGGOT00000030989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSNAGGGQGGCQGLTCDSESVGTLDILDQMQACPVSLASSSARPPCPPPGQCAKPSGCIA
MAVWSPLVMPGRREGCCHTPVTNEETEAREAKGQKLRPCHTLGVHVCLSLFRSELLGLLK
TYNCYHEGKSFQLRHREEEGTLIIEGLLNIAWGLRRPIRLQMQDDREQVHLPSTSWMPGR
PSCPPKEPSPQNGNITAQGPSIQPVHKAESSTDSSGPLEEAEEAPQLMRTKSDASCMSQR
RPKCRAPGEAQRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRVNSTMTTLQVLTLLLNK
FRVEDGPSEFALYIVHESGERTKLKDCEYPLISRILHGPCEKIARMFLMEADLGVEVPHE
VAQYIKFEMPVLDSFVEKLKEEEEREIIKLTMKFQALRLTMLQRLEQLVEAK
Download sequence
Identical sequences ENSGGOP00000017071 ENSGGOP00000017071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]