SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017090 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017090
Domain Number 1 Region: 289-361
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000000523
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 71-105
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000068
Family Intermediate filament protein, coiled coil region 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017090   Gene: ENSGGOG00000022348   Transcript: ENSGGOT00000034280
Sequence length 405
Comment pep:novel chromosome:gorGor3.1:14:51773515:51774795:1 gene:ENSGGOG00000022348 transcript:ENSGGOT00000034280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFTTHSTFSNYWSLGSIQAPSCSTQPVSSTASVYTGTGGSVSQISMSRLGVQEPGHGMA
RVLAGMGGIQNEEETMQSLNLPLASYPDRVRSLETENQRLESKIQEHLDKKGPQVRDWGH
YFKTIEDLRAQIFSNTVDNAHIVLQIDNAHLAADRVKYETELAMYQSVESNIHGLCKVND
TNVTRLQLQTEIEALKEELLFMKNREEEVKLQAQTASSGLTMKVDTPKSQDLAKIIGDIL
IRRAGSEELRGARQIEESTTVVTMQSAKVGAAEVTLTELRGTVQSLETDLDSMRNLKASL
ENSLREVEARYTLQMEQLNRILLYLELELAQAGAERQHQAQEYEALLNIKAEITTYRRLL
EDSQDFNLGDALDSSNSMQTIQKTTRQVVDGRVVSETNNIKILRH
Download sequence
Identical sequences ENSGGOP00000017090 ENSGGOP00000017090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]