SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017259 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017259
Domain Number 1 Region: 66-351
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.5e-95
Family G proteins 0.000000266
Further Details:      
 
Domain Number 2 Region: 334-452
Classification Level Classification E-value
Superfamily Translation proteins 2.59e-25
Family Elongation factors 0.00071
Further Details:      
 
Domain Number 3 Region: 561-680
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.3e-21
Family Translational machinery components 0.0027
Further Details:      
 
Domain Number 4 Region: 485-562
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.15e-20
Family EF-G/eEF-2 domains III and V 0.00025
Further Details:      
 
Domain Number 5 Region: 683-742
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.00000000106
Family EF-G/eEF-2 domains III and V 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017259   Gene: ENSGGOG00000013739   Transcript: ENSGGOT00000022914
Sequence length 743
Comment pep:novel chromosome:gorGor3.1:17:23007837:23071997:1 gene:ENSGGOG00000013739 transcript:ENSGGOT00000022914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTNLRIFAMSHQTIPSVYINNICCYKIRASLRRLKPHVPLGRNCSSLPGLIGNDIKSLH
SIINPPIAKIRNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDTVTDFMAQERERG
ITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVW
RQADKHNIPRICFLNKMDKTGASFKYAVESIREKLKAKPLLLQLPIGEAKTFKGVVDVVT
KEKLLWNCNSNDGKDFERKPLLEMNDPELLKETTEARNALIEQVADLDDEFADLVLEEFS
ENFDLLPAEKLQTAIHRVTLAQTAVPVLCGSALKNKGIQPLLDAVTMYLPSPEERNYEFL
QWYKDDLCALAFKVLHDKQRGPLVFMRIYSGTIKPQLAIHNINGNCTERISRLLLPFADQ
HVEIPSLTAGNIALTVGLKHTATGDTIVSSKSSALAAARRAEREGEKQHRQNNEAERLLL
AGVEIPEPVFFCTIEPPSLSKQPDLEHALKCLQREDPSLKVRLDPDSGQTVLCGMGELHI
EIIHDRIKREYGLETYLGPLQVAYRETILNSVRATDTLDRTLGDKRHLVTVEVEARPIET
SSVMPVIEYAESINEGLLKVSQEAIENGIHSACLQGPLLGSPIQDVAITLHSLTIHPGTS
TTMISACVSRCVQKALKKADKQVLEPLMNLEVTVARDYLSPVLADLAQRRGNIQEIQTRQ
DNKVVIGFVPLAEIMISYSTILQ
Download sequence
Identical sequences ENSGGOP00000017259 ENSGGOP00000017259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]