SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017297 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017297
Domain Number 1 Region: 52-169
Classification Level Classification E-value
Superfamily C-type lectin-like 1.31e-31
Family C-type lectin domain 0.00000482
Further Details:      
 
Domain Number 2 Region: 213-277
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000959
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 3 Region: 273-335
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000011
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 4 Region: 170-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000252
Family EGF-type module 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017297   Gene: ENSGGOG00000024661   Transcript: ENSGGOT00000025472
Sequence length 389
Comment pep:novel chromosome:gorGor3.1:1:148896132:148917189:-1 gene:ENSGGOG00000024661 transcript:ENSGGOT00000025472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKP
LNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSL
TEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKQKAALCYTASCQPWSCSG
HGECVEIINNYTCNCDVGYYGPQCQFAIEVIQCEPLEAPELGTMDCTHPLGNFSFSSQCA
FSCSEGTNLTGIEETTCGPFGNWSSPEPTCQEVIQCEPLSAPDLGIMNCSHPLASFSFTS
ACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVT
AFSGLAFIIWLARRLKKGKKSKKSMDDPY
Download sequence
Identical sequences ENSGGOP00000017297 ENSGGOP00000017297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]