SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017408 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017408
Domain Number 1 Region: 5-280
Classification Level Classification E-value
Superfamily L domain-like 4.19e-54
Family Internalin LRR domain 0.093
Further Details:      
 
Domain Number 2 Region: 239-392
Classification Level Classification E-value
Superfamily L domain-like 8.5e-28
Family Internalin LRR domain 0.025
Further Details:      
 
Domain Number 3 Region: 844-955
Classification Level Classification E-value
Superfamily PDZ domain-like 1.24e-25
Family PDZ domain 0.0000404
Further Details:      
 
Domain Number 4 Region: 716-814
Classification Level Classification E-value
Superfamily PDZ domain-like 9.2e-25
Family PDZ domain 0.000024
Further Details:      
 
Domain Number 5 Region: 1005-1096
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-24
Family PDZ domain 0.0056
Further Details:      
 
Domain Number 6 Region: 1099-1194
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-23
Family PDZ domain 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017408   Gene: ENSGGOG00000004635   Transcript: ENSGGOT00000033582
Sequence length 1639
Comment pep:novel chromosome:gorGor3.1:8:143980506:144009032:-1 gene:ENSGGOG00000004635 transcript:ENSGGOT00000033582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCIPLWRCNRHVESVDKRHCSLQAVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLN
LRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRL
PDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLD
LGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPAELG
GLVLLTDLLLSQNLLRRLPDGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENL
LMALPRSLGKLTKLTNLNVDRNHLEALPPEIGGCVALSVLSLRDNRLAVLPPELAHTAEL
HVLDVAGNRLQSLPFALTHLNLKALWLAENQAQPMLRFQTEDDARTGEKVLTCYLLPQQP
PPSLEDAGQQGSLSETWSDAPPSRVSVIQFLEAPTGDEDAEEAAAEKRGLQRRATPHPSE
LKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVSEAEPEGPS
AEAQGGNQQEATTAGGEEDAEEDYEEPTVHFAEDALLPGDDREIEEGQPEAPWTLPGGRQ
RLIRKDTPHYKKHFKISKLPRPEAVVALLQGMQPDGEGPVAPGGWHNGPHAPWAPRAQEE
EEEEGSPREEEEEEEEENRAEEEEASTEEEDKEGAVVSAPSVKGVSFDQANNLLIEPARV
EEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLE
VNGVALQGAEHHEAVEALRGAGTAVQMRVWRERMVEPENAVTITPLRPEDDYSPRERRGG
GLRLPLLPPESPGPLRQRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFVSRIAEGGA
AHRAGTLQVGDRVLSINGVDVTEARHDHAVSLLTAASPTIALLLEREAGGPLPPSPLPHS
SPPTAAVATTSTTTTSITTATPGEPGLPSLAPSLLAAALEGPYPVEEIRLPRAGGPLGLS
IVGGSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVRDATHQEAVSA
LLRPCLELSLLVRRDPAPPGLRELCIQKAPGERLGISIRGGARGHAGNPRDPTDEGIFIS
KVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEAVQLLRSVGDTLTVLVCDGFEASTA
AALEVSPGVIANPFAAGIGHRNSLESISSIDRELSPEGPGKGRGLQPLKLDYRALAAVPS
AGSVQRVPSGAAGGKMAESPCSPSGQQPPSPPSPDELPANVKQAYRAFAAVPTSHPPEDA
PAQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLVGADDLRKMQEEEARKL
QQKRAQMLREAAEAGAEARLALDGEMLGEEEQEDEQPPWASPSPTSRQSPASPPPLGGGA
PVRTAKAERRHQERLRVQSPEPPAPERALSPAERRALEAEKRALWRAARMKSLEQDALRA
QMVLSRSQEGRGTRGPLERLAEAPSPAPTPSPTPVEDLGPQTSTSPGRLPLSGKKFDYRA
FAALPSSRPVYDIQSPDFAEELRSLELSPSPGPQEEDGEVALVLLGRPSPGTVGPEDVAL
CSSRRPVRPGRRGLGPVPS
Download sequence
Identical sequences ENSGGOP00000017408 ENSGGOP00000004548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]