SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017434 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017434
Domain Number 1 Region: 367-550
Classification Level Classification E-value
Superfamily NTF2-like 2.12e-60
Family NTF2-like 0.00000133
Further Details:      
 
Domain Number 2 Region: 104-196
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.28e-31
Family Non-canonical RBD domain 0.00014
Further Details:      
 
Domain Number 3 Region: 203-353
Classification Level Classification E-value
Superfamily L domain-like 1.48e-29
Family mRNA export factor tap 0.00000534
Further Details:      
 
Domain Number 4 Region: 547-617
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000224
Family TAP-C domain-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017434   Gene: ENSGGOG00000028031   Transcript: ENSGGOT00000024877
Sequence length 621
Comment pep:novel chromosome:gorGor3.1:X:99792350:99802447:1 gene:ENSGGOG00000028031 transcript:ENSGGOT00000024877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTDVFKLVFLFQISEHSDGRSSPQGENKGGDSSQGNFGKKNLHDEHGGYELPPPHLQKE
DENVEVGDVHEDPQIRNNPSTLQPDSRSVKCHSEYQDRIPPEREVEKNTQNGDPGTWFKV
TIPYGIKYDWIVNSIQSHCSVPFTPVAFHYNKNQAHFFIQDASAACALKKVNCKIHDEEN
QKVFVFVTLSTKPQSIQKMLKPKEMAQLKLTLNKRYDVSQQALDLQRLRFDPDLVKHHID
IILNQRNYMAATLKIIERNFPELLSLNLCDNKLYHLDGLSDIIEKAPKVKTLNLSKKKLK
SAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSIIREYFPKLLRLDGQELASPIIIGI
EAPEIIKPCKESYKGSETIKSLVLQFLLQYYLIYDSEDRTGLLSVYHDKACFSLTITLNP
EDPEPSSLEKYFKDSRNIKNIKDLRLRIQLLKHTKREIVDSLSVLPRTQHDLNSYVVDLC
IQTERMLVFSVNGVFKEVERESPGSVLAFTRTFILTSVGNSNLYIVNDKLIVRNASTKKT
QSAFSIPVPAPSSSSLPTLSQKQQEMVETVSTQSGMKLEQSQKCGASKNEWPHKNYTKAD
QVFTMLQTKSKISVEAFKQIP
Download sequence
Identical sequences ENSGGOP00000017434 ENSGGOP00000017434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]