SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017440 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017440
Domain Number 1 Region: 300-377
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 5.93e-21
Family Intermediate filament protein, coiled coil region 0.00059
Further Details:      
 
Domain Number 2 Region: 70-104
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000251
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000017440
Domain Number - Region: 9-31,387-443
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000204
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 194-300
Classification Level Classification E-value
Superfamily Prefoldin 0.00068
Family Prefoldin 0.011
Further Details:      
 
Domain Number - Region: 108-178
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000889
Family Intermediate filament protein, coiled coil region 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017440   Gene: ENSGGOG00000002785   Transcript: ENSGGOT00000031908
Sequence length 453
Comment pep:novel chromosome:gorGor3.1:12:50334793:50341838:-1 gene:ENSGGOG00000002785 transcript:ENSGGOT00000031908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCGFNSIGCGFRPGNFSCVSACGPRPSRCCITAAPYRGISCYRGLTGGFGSHSVCGGFG
AAPADAASXEEKEQIKSLNSRFAAFIDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLF
AGYIETLRREAECVEADSGRLASELNHVQEVLEGYKKKYEEEVALRATAENEFVALKKDV
DCAYLRKSDLEANVEALIQEIDFLRRLYEEEIRILQSHISDTSVVVKLDNSRDLNMDCIV
AEIKAQYDDIATRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAE
VENAKCQNSKLEAAVAQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNS
KLGLDIEIATYRRLLEGEEQRLCEGVEAVNVCVSSSRGGVVCGDLCVSGSRPVTGSVCSA
PCNGNLVVSTGLCKPCGQLNTTCGGGSCSQGRY
Download sequence
Identical sequences ENSGGOP00000017440 ENSGGOP00000017440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]