SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017477 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017477
Domain Number 1 Region: 299-377
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.96e-23
Family Intermediate filament protein, coiled coil region 0.00081
Further Details:      
 
Domain Number 2 Region: 70-103
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000471
Family Intermediate filament protein, coiled coil region 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017477   Gene: ENSGGOG00000025840   Transcript: ENSGGOT00000031122
Sequence length 422
Comment pep:novel chromosome:gorGor3.1:5:43192086:43206102:1 gene:ENSGGOG00000025840 transcript:ENSGGOT00000031122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGHSFNQTPSASFHGAGGGWGRPRSFPRAPTIHGGAGGARISLSFTTRSCPPAGGSWG
SGRSSPLLGGNGKATMQNLNDRLASYLEKVRALEEANMKLESRILKWHQQRDPGSKKDYS
QYEENITHLQEQIVDGKMTNAQIILLIDNARMAVDDFNLKYENEHSFKKDLEIEVEGLRR
TLDNLTIVTTDLEQEVEGMRKELILMKKRHEQEMEKHHVPSDFSVNVKVDTGPREDLIKV
LEDMRQEYELIIKKKHRDLDTWYKEQSAAMSQEAASPATVQSRQGDIHELKRTFQALEID
LQAQYSTKSALENMLSETQSRYSCKLQDMQEIISNYEEELMQLRHELERQNNEYQVLLGI
KTHLEKEITTYRRLLEGESEGTREESKSSMKASATPKIKAITQETINGRLVLCQVNEIQK
HA
Download sequence
Identical sequences G3RNV9
XP_018882206.1.27298 ENSGGOP00000017477 ENSGGOP00000017477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]