SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017510 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017510
Domain Number 1 Region: 4-110
Classification Level Classification E-value
Superfamily L domain-like 0.0000000034
Family Internalin LRR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017510   Gene: ENSGGOG00000027983   Transcript: ENSGGOT00000025985
Sequence length 111
Comment pep:novel chromosome:gorGor3.1:12:46409670:46410066:1 gene:ENSGGOG00000027983 transcript:ENSGGOT00000025985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMGKWIHLELWNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLNTINIGLTSIANL
PKLNKLKKLELSSNRASVGLEVLSTIEPLKKLENLESLDLFNCEVTNLNDY
Download sequence
Identical sequences ENSGGOP00000017510 ENSGGOP00000017510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]