SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017529 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017529
Domain Number 1 Region: 239-304
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.41e-16
Family Intermediate filament protein, coiled coil region 0.0012
Further Details:      
 
Domain Number 2 Region: 17-41
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000497
Family Intermediate filament protein, coiled coil region 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017529   Gene: ENSGGOG00000027457   Transcript: ENSGGOT00000031904
Sequence length 384
Comment pep:novel chromosome:gorGor3.1:X:136129284:136130508:-1 gene:ENSGGOG00000027457 transcript:ENSGGOT00000031904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKVEVDPNIQAVGAQEKEFASFIDKVQFLEQQNKMLETKWSLVPQQKAAWNNIMFDNYIN
NLWKHLETLGKKLKLEADLEYIQGLVENFRNKYKDEINKHTYNEFVLNKKDVDEAYMNKV
ELRSQLKELTHEINFLRQLYEEKILRCSPSFWTHLWFLSMGNSHSLDVDRIIAKCAQCEG
IASRNPAEAENMHQNKYEGLQMLPGKHRDDLCCTKMDLSEMNWNISQLPQKPDGLPDAAV
EDAKQCGELAVKDVNAKLVALEAAPQGANQDMAQQLREYQELMKFKLALDIKIATYRRLL
EDEKSWMESGMSNMSIRRKTTSGYSGGLSLAYGSLTSYSLGSGFGSGRGSDAFSHRSSSR
AMVVKIIETRDGKLVSGSPDVLPK
Download sequence
Identical sequences ENSGGOP00000017529 ENSGGOP00000017529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]