SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017773 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017773
Domain Number 1 Region: 365-474
Classification Level Classification E-value
Superfamily E set domains 1.29e-30
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000239
Further Details:      
 
Domain Number 2 Region: 194-362
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.91e-21
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017773   Gene: ENSGGOG00000006817   Transcript: ENSGGOT00000030384
Sequence length 1425
Comment pep:novel chromosome:gorGor3.1:16:59831073:59897868:1 gene:ENSGGOG00000006817 transcript:ENSGGOT00000030384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGACSSFTTSSSPTIYSTSVTDSKAMQVESCSSAVGVSNRGVSEKQLTSNTVQQHPSTP
KRHTVLYISPPPEDLLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTE
VPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGILS
SLCKTNNQKTFPIFPNCSAQKDLKIFLRHQKDYAAQYKTEYHRLSSKDSTYSPFPLKFQL
EGHNEPVVLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSNNM
TLAVYCLEMVELVLSCLKTQIELADSKFLNTLKKNFTRIKLKKKKSNRLVLSVMFETILI
SQPAGVPEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMEL
FHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPDTAAAGALNVNVKKE
ISSPARPCSFEEAMKAMKTTGCNLDKVNIIPNALITPLIPSSMIKSEDVTPMEVTAEKRS
STIFKTTKSVGSTQQTLENISNIAGNGSFSSPSSSHLPSENEKQQQIQPKAYNPETLTTI
QTQDISQPGTFPAVSASSQLPNSDALLQQATQFQTRETQSREVLQSDGTVVNLSQLTEAS
QQQQQSPLQEQAQTLQQQISSNIFPSPNSVSQLQNTIQHLQAGSFTGSTASGSSGSVDLV
QQVLEAQQQLSSVLFSAPDGNENVQEQLSADIFQQVSQIQSGVSPGMFSSTEPTVHTRPD
NLLPGRAESVHPQSENTLSKVMESSAAMVMEMQQSICQAAAQIQSELFPSTASANGNLQQ
SPVYQQTSHMMSALSTNEDMQMQCELFSSPPAVSGNETSTTTTQQVATPGTTMFQTSSSG
DREETGTQAKQIQNSVFQTMVQMQHSGDNQPQVNLFSSTKSMMSVQNSGTQQQGNGLFQQ
GNEMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQNLSQETQGSLFHSPNPIVHSQTSTTS
SEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPMNNLQTNTVAQEAFFAAPNSIS
PLQSTSNSEQQAAFQQQAPISHIQTPMLSQEQAQPPQQGLFQPQVALGSLPPNPMPQSQQ
GTMFQSQHSIVAMQSNSPSQSILFGNQNTMATMASPKQPPPNMIFNPNQNPMANQEQQNQ
SIFHQQSNMAPMNQEQQPMQFQSQSTVSSLQNPGPTQSESSQTPLFHSSPQIQLVQGSPS
PQEQQVTLFLSPASMSALQTSINQQDMQQSPLYSPQNNMPGIQGATSSPQSQATLFHNTA
GGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPP
VTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF
Download sequence
Identical sequences ENSGGOP00000017773 ENSGGOP00000017773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]