SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017840 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017840
Domain Number 1 Region: 284-354
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000146
Family Intermediate filament protein, coiled coil region 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000017840
Domain Number - Region: 81-112
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000387
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017840   Gene: ENSGGOG00000028210   Transcript: ENSGGOT00000023221
Sequence length 404
Comment pep:novel chromosome:gorGor3.1:6:127090881:127092173:-1 gene:ENSGGOG00000028210 transcript:ENSGGOT00000023221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSTRLESSSSFLRVLSGPGTARWQSSSQSYMTMSTTLASLGSALCLGSSCSLFILFPVFC
VCQKLLHHVPSTATWKKNARTNGKMELQELNDGFIHIDKVHFLVQKNKILLIKEAAPEIG
KVNLGNFYKEEMQQLHQQVDQVTNKASIKAQHDILAKDIMTICRKRCFRERKLRAPLEIL
QTCRLHVDNASLALHDFAISSLQEEIAFLKELRRNETWELQVQIQEEIQIDDISKTDLMA
ALRDYESVVTKNLREPGQAKQESKEYQRQVQSLTGQALKGIEKSLQCQMCEIDENFAVNY
QDTIGLMQDEIQNGKEEIIKACRLNQCQDLWDAHRALDFEIATYRMLLEGEESRISLSLP
NFSSQNWRETILCSLPLVDSHSYRTLLTFKTDGQVINEPSQPHD
Download sequence
Identical sequences ENSGGOP00000017840 ENSGGOP00000017840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]