SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017853 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017853
Domain Number 1 Region: 171-429
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-75
Family Protein kinases, catalytic subunit 0.00000000583
Further Details:      
 
Domain Number 2 Region: 61-203
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-37
Family SH2 domain 0.00000248
Further Details:      
 
Domain Number 3 Region: 3-85
Classification Level Classification E-value
Superfamily SH3-domain 2e-20
Family SH3-domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017853   Gene: ENSGGOG00000005127   Transcript: ENSGGOT00000022100
Sequence length 526
Comment pep:novel chromosome:gorGor3.1:8:11234258:11250772:1 gene:ENSGGOG00000005127 transcript:ENSGGOT00000022100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKHFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVES
LEMERWFFRSLGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYK
IRSLDEGGYYISPRITFPSLQALVQHYSKKGDGLCQRLTLPCVSPALQNPWAQDEWEIPR
QSLRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKALQHERLVR
LYAVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAYIERMNSIH
RDLRAANILVSEALCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADV
WSFGVLLMEVVTYGRVPYPGMSNPEVIRSLERGYRMPRPDTCPPELYRGVIAECWRSRPE
ERPTFDCTLGRVTRPLCAASFVEGCNSDLARSSRVLSPSKVFRTGKRLSSSKPRAGRVPA
SAPCVDPALPRYRSQTGSRGRQQGQPQPRLRSSTAGLFCNKVTSVR
Download sequence
Identical sequences ENSGGOP00000005025 ENSGGOP00000017853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]