SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017911 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017911
Domain Number 1 Region: 299-376
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.62e-20
Family Intermediate filament protein, coiled coil region 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000017911
Domain Number - Region: 76-105
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000262
Family Intermediate filament protein, coiled coil region 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017911   Gene: ENSGGOG00000022074   Transcript: ENSGGOT00000033262
Sequence length 389
Comment pep:novel chromosome:gorGor3.1:13:73123970:73125173:1 gene:ENSGGOG00000022074 transcript:ENSGGOT00000033262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFTTRSTLSTNYHSLGSVRASSYGALPGSSAAIVYAAARGPGSRISVSRSTSFLGGMGS
RGLAMRMAGDLAGMNEETMQSMNDRLASYLEVRSLETENPKLKSKILKSKIREHLEKKGP
QDRDWSHYFKTIEELRAQIFTNIVDNAHIVLRIDNARLAADDLRVKYETKLAMRQSVESD
IHGLCKVIDDTNVTQLQETEIEALKEELLFMKKNQEEEVKGLQAQIDSSGLTMEVEAPKS
QDLTKIMADIAQYDELAGKNREKLDKYWSQQIEESTTVVITQSAEVGAAEMTLTESLEID
LDSMRNLKASLENSLREVEACYALQMGQLNAILLHLESELAQTRAEGQRQAQEYEALLNI
KVKLEAEIATYCSPLEDRENFNHGDALDS
Download sequence
Identical sequences ENSGGOP00000017911 ENSGGOP00000017911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]