SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017971 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017971
Domain Number 1 Region: 204-281
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.71e-23
Family Intermediate filament protein, coiled coil region 0.0000945
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000017971
Domain Number - Region: 19-110
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000314
Family Myosin rod fragments 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017971   Gene: ENSGGOG00000011976   Transcript: ENSGGOT00000026134
Sequence length 886
Comment pep:novel chromosome:gorGor3.1:22:13560420:13570708:1 gene:ENSGGOG00000011976 transcript:ENSGGOT00000026134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAAALRQQQAGRSAMGELYEREVREMRGAVLRLGAARGQLRLEQEHLLEDIAHLCQRLDN
EARQREEAEAAARALARFAQEAEAARVDLQKKAQALQEECGYLRRHHQEEVGELLGQIQG
SGAAQAQMQAETRDALKCDVTSALREIRAQLEGHAVQSTLQSEEWFRVRLDRLSEAAKVN
TDAMRSAQEEITEYRRQLQARTTELEALKSTKDSLERQRSELEDRHQADIASYQEAIQQL
DAELRNTKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEECRIGFGPIPFSLPEGLP
KIPSVSTHIKVKSEEKIKVVEKSEKETVIVEEQTEETQVTEEVTEEEEKEAKEEEGKEEE
GGEEETKSPPAEEAASPEKEAKSPAKEEAKSPAEAKSPEKEEAKSPAEVKSPEKAKSPAK
EEAKSPAEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKSPAEAKSPEKAKSPVKEEAKSP
AEVKSPAKEEAKSPEKAKSPEKEEAKSPVKAEAKSPEKAKSPVKEEAKSPEKAKSPVKEE
AKTPEKAKSPVKEEAKSPEKAKSPVKEEAKSPEKAKSPVKEEAKSPEKAKSPVKEEAKSP
EKAKSPVKEEAKSPEKAKSPEKAKTLDVKSPEAKTPAKEEARSPADKSPEKAKSPVKEEV
KSPEKAKSPLKEDAKAPEKEIPKKEEVKSPVKEEKKPQEVKVKEPPKKAEEEKAPATPKT
EEKKDSKKEEAPKKEAPKPKVEEKEPAVEKPKESKVEAKKEEAEDKRKVPTPEKEAPAKV
EVKEDAKPKEKTEVAKKEPDDAKAKEPSKPAEKKEAAPEKKDTKEEKAKKPEEKPKTEAK
AKEDDKTLPKEPSKPKAEKAEKSSSTDQKDSRPPEKATEDKAAKGK
Download sequence
Identical sequences ENSGGOP00000011681 ENSGGOP00000017971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]