SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017996 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017996
Domain Number 1 Region: 39-219
Classification Level Classification E-value
Superfamily vWA-like 1.42e-31
Family Integrin A (or I) domain 0.0000000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017996   Gene: ENSGGOG00000023286   Transcript: ENSGGOT00000022671
Sequence length 492
Comment pep:novel chromosome:gorGor3.1:4:88726401:88820693:-1 gene:ENSGGOG00000023286 transcript:ENSGGOT00000022671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAERSPARSPGSWLFTGLWLLVLSGPGGLLRAQEQPSCRRAFDLYFVLDKSGSVANNWI
EIYNFVQQLAERFVSPEMRLSFIVFSSQASIILPLTGDRGKLSKEIREIQIELKVLISYT
SEGLEYEANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVL
DFEQAQLERIADSKEQVFPVKGGFQALKGIINSVLGKSCGVKIKREPNKHSEGEEDIRIV
RCGRKFYLKMKKSYLNCLYTNNSTVYYTCVKPVSVQLNSMLCPAPILNKAGETLDVSVSF
NGGKSVISGSLIVTATECSNGIAAIIVILVLLLLLGIGLMWWFWPLCCKVVIKDPPPPPT
PAPKEEEEEPLPTKKWPTVDASYYGGRGVGGIKRMEVRWGDKGSTEEGARLEKAKNAVVK
IPEETEEPIRPRAPRPKPTHQPPQTKWYTPIKGRLDALWALLRRQYDRVSLMRPQEGDEV
CIWECIEKELTA
Download sequence
Identical sequences ENSGGOP00000017996 ENSGGOP00000017996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]