SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018044 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018044
Domain Number 1 Region: 725-1004
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.52e-57
Family Tandem AAA-ATPase domain 0.0000868
Further Details:      
 
Domain Number 2 Region: 496-723
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.49e-28
Family Tandem AAA-ATPase domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000018044
Domain Number - Region: 246-295
Classification Level Classification E-value
Superfamily UBA-like 0.000536
Family CUE domain 0.026
Further Details:      
 
Domain Number - Region: 394-431
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00623
Family ComEA-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018044   Gene: ENSGGOG00000023001   Transcript: ENSGGOT00000030217
Sequence length 1027
Comment pep:novel chromosome:gorGor3.1:4:103272818:103356024:1 gene:ENSGGOG00000023001 transcript:ENSGGOT00000030217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLFNLDRFRFEKRNKIEEAPEATPQPSQPGPSSPISLSAEEENAEGEVSRANTPDSDIT
EKTEDSSVPETPDNERKASISYFKNQRGIQYIDLSSDSEDVVSPNCSNTVQEKTFNKDTV
IIVSEPSEDEESQGLPTMARRNDDISELEDLHFSKDILRLKILTIKSKINKQSENDVMQL
IESTSTMDGAIAAALLMFGDAGGGPRKRKLSSSSEPYEEDEFNDDQSIKKTRLDHGEESN
ESAESSSNWEKQESIVLKLQKEFPNFDKQELREVLKEHEWMYTEALESLKVFAEDQDMQY
ASQSEVPNGKEVSSRSQNYPKNATKTKLKQKFSMKAQNGFNKKRKKNVFNPKRVVEDSEY
DSGSDVGSSLDEDYSSGEEVMEDGYKGKILHFLQDASIGELTLIPQCSQKKAQKITELRP
FNSWEALFTKMSKTNGLSEDLIWHCKTLIQERDVVIRLMNKCEDISNKLTKQVTMLTGNG
GGWNIEQPSILNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYLY
QEGNNGPHLIVVPASTIDNWLREVNLWCPTLKVLCYYGSQEERKQIRFNIHSRYEDYNVI
VTTKVYAVNCDTKSSCNSNFSVKLKFNKILCFKEKHVLASRSFLCLLKYNTSWSRLLTSY
TQIDLLPAENMITYHKTSKYIWSFKKYMAAQNSAQKSADEQSIYEKERIAHAKQIIKPFI
LRRVKEEVLKQLPPKKDRIELCAMSEKQEQLYLGLFNRLKKSINNLEKNTEMCNVMMQLR
KMANHPLLHRQYYTAEKLKEMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYRH
INNFQLDMDLILDSGKFRVLGCILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLR
LDGKTQISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQA
EDRCHRVGQTKEVLVIKLISQGTIEESMLKINQQKLKLEQDMTTVDEGDEGSMPADIATL
LKTSMGL
Download sequence
Identical sequences ENSGGOP00000018044 ENSGGOP00000018044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]