SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018050 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018050
Domain Number 1 Region: 38-293
Classification Level Classification E-value
Superfamily L domain-like 1.8e-46
Family Ngr ectodomain-like 0.037
Further Details:      
 
Domain Number 2 Region: 286-376
Classification Level Classification E-value
Superfamily Immunoglobulin 2.65e-18
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 424-497
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000126
Family Fibronectin type III 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018050   Gene: ENSGGOG00000022719   Transcript: ENSGGOT00000026774
Sequence length 721
Comment pep:novel chromosome:gorGor3.1:14:23229309:23242279:1 gene:ENSGGOG00000022719 transcript:ENSGGOT00000026774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STMEKILFYLFFIGIAVKAQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRL
ADNFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDM
FSGLSNLHHLILNNNQLTLISSTAFDDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSL
DHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQVLATSGIISPSTFALSFG
GNPLHCNCELLWLRRLSREDDLETCASPPLLTGRYFWSIPEEEFLCEPPLITRHTHEMRV
LEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYDNGTLDILITTVKDTGAFTCI
ASNPAGEATQIVDLHIIKLPHLLNSTNHIHEPDPGSSDISTSTKSGSNTSSSNGDTKLSQ
DKIVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYDDTLVYRMIPPTSKTFLVNNLAA
GTMYDLCVLAIYDDGITSLTATRVVGCIQFTTEQDYVRCHFMQSQFLGGTMIIIIGGIIV
ASVLVFIIILMIRYKVCNNNGQHKVTKVSNVYSQTNGAQIQGCSVTLPQSVSKQAVGHEE
NAQCCKASSDNVIQSSETCSSQDSSTTTSALPPSWTSSTSVSQKQKRKTGTKPSTEPQNE
AVTNVESQNTNRNNSTALQLASRPPDSVTEGPTSKRAHIKPNALLTNVDQIVKETQNLES
H
Download sequence
Identical sequences ENSGGOP00000018050 ENSGGOP00000018050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]