SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018065 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018065
Domain Number 1 Region: 25-118
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.01e-42
Family MHC antigen-recognition domain 0.00000307
Further Details:      
 
Domain Number 2 Region: 116-214
Classification Level Classification E-value
Superfamily Immunoglobulin 5.08e-26
Family C1 set domains (antibody constant domain-like) 0.00000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018065   Gene: ENSGGOG00000022404   Transcript: ENSGGOT00000031725
Sequence length 268
Comment pep:known chromosome:gorGor3.1:6:33893155:33899550:-1 gene:ENSGGOG00000022404 transcript:ENSGGOT00000031725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTEQSMITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWD
PEENKMAPCEFGVLNSLANVLSQHLNQQDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPP
SVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQ
TLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSL
GVISWRRAGHSSYTPLPGSNYSEGWHIS
Download sequence
Identical sequences Q8SP83 Q8SPE4
ENSGGOP00000018065 ENSGGOP00000018065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]