SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018124 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018124
Domain Number 1 Region: 65-131
Classification Level Classification E-value
Superfamily BPTI-like 2.13e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0023
Further Details:      
 
Domain Number 2 Region: 30-71
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000785
Family Elafin-like 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000018124
Domain Number - Region: 133-171
Classification Level Classification E-value
Superfamily Elafin-like 0.00419
Family Elafin-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018124   Gene: ENSGGOG00000014420   Transcript: ENSGGOT00000030035
Sequence length 179
Comment pep:novel chromosome:gorGor3.1:20:43377106:43382827:-1 gene:ENSGGOG00000014420 transcript:ENSGGOT00000030035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSGLLSLLVLFVLLVNVQGPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKC
CVFSCGKKCLDLKQDVCEMPKETGPCLAYFLRWWYDKKNNSCSMFVYGGCQGNNNNFQSK
ANCLNTCRNKQPCPKIKVECEVEEIDQRTKPRDCPENMKCCLFSRGKKCLDFRKASLST
Download sequence
Identical sequences ENSGGOP00000014064 ENSGGOP00000018124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]